4MVI: Engineered lipocalin

Crystal structure of an engineered lipocalin (Anticalin US7) in complex with the Alzheimer amyloid peptide Abeta(1-40). Determined by X-ray diffraction at 1.7 Å resolution. Released 12 Aug 2015.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,577
Mol. weight: 25.87 kDa
Released: 12 Aug 2015

Explore 4MVI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MVI contains 9 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	8-12	5
α-helix	13-15	3
α-helix	24-27	4
β-strand	29-38	10	1
α-helix	47-49	3
β-strand	50	1	2
α-helix	51	1
β-strand	53-58	6	1
β-strand	64-71	8	1
β-strand	76-85	10	1
β-strand	91-94	4	1
β-strand	104-113	10	1
β-strand	118-127	10	1
β-strand	130-139	10	1
α-helix	146-158	13
α-helix	163-165	3
β-strand	166-167	2	1
α-helix	169	1
β-strand	170	1	2
α-helix	171	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neutrophil gelatinase-associated lipocalin	A	protein	188	Homo sapiens	P80188 (AlphaFold model)
Beta-amyloid protein 40	B	protein	40	Homo sapiens	P05067 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MVI_1 Neutrophil gelatinase-associated lipocalin (chains A)
QDSTSDLIPAPPLSKVPLQQNFQDNQFHGKWYVVGVAGNKSLREDKDPWKMYATIYELKE
DKSYNVTSVGFGTKKCHYKIRTFVPGSQPGEFTLGRIKSRPGRTSALVRVVSTNYNQHAM
VFFKVVQQNRESFNITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGSA
WSHPQFEK

Sequence of entity 2 (B), FASTA

>4MVI_2 Beta-amyloid protein 40 (chains B)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Primary citation

High-affinity Anticalins with aggregation-blocking activity directed against the Alzheimer beta-amyloid peptide. Rauth, S., Hinz, D., Borger, M. et al. Biochem J (2016) 473:1563-1578. DOI 10.1042/BCJ20160114 · PubMed

Other PDB entries of the same protein (UniProt P80188 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GQZ 1.4 Å, Petrobactin-binding engineered lipocalin without ligand
4MVK 1.5 Å, Crystal structure of an engineered lipocalin (Anticalin US7) in complex with the…
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
6Z6Z 1.78 Å, Crystal structure of an Anticalin directed towards colchicine without ligand
6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
6Z2C 1.8 Å, Engineered lipocalin C3A5 in complex with a transition state analog
4IAX 1.9 Å, Engineered human lipocalin 2 (CL31) in complex with Y-DTPA
6QMU 1.98 Å, A tetrahedral boronic acid diester formed by a non-natural amino acid in the ligand…
3DSZ 2.0 Å, Engineered human lipocalin 2 in complex with Y-DTPA
5MHH 2.0 Å, Crystal structure of engineered human lipocalin 2 carrying p-boronophenylalanine at…
8UYN 2.0 Å, Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular…
4ZHC 2.04 Å, Siderocalin-mediated recognition and cellular uptake of actinides

Browse structure collections

About this viewer

MolViewer shows 4MVI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.