Structure of ricin A chain bound with benzyl-(2-(2-amino-4-oxo-3,4-dihydropteridine-7-carboxamido)ethyl)carbamate. Determined by X-ray diffraction at 1.52 Å resolution. Released 15 Jan 2014.
Explore 4MX5 in 3D Show helices and sheets RCSB PDB PDBe
4MX5 contains 16 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 1 |
| α-helix | 18-32 | 15 | |
| β-strand | 38-39 | 2 | 2 |
| β-strand | 42-43 | 2 | 2 |
| β-strand | 44 | 1 | 3 |
| α-helix | 45-47 | 3 | |
| α-helix | 53-55 | 3 | |
| β-strand | 57-63 | 7 | 1 |
| β-strand | 69-75 | 7 | 1 |
| β-strand | 81-86 | 6 | 1 |
| β-strand | 89-92 | 4 | 1 |
| α-helix | 93-95 | 3 | |
| α-helix | 98-104 | 7 | |
| β-strand | 113-116 | 4 | 1 |
| α-helix | 123-130 | 8 | |
| α-helix | 134-136 | 3 | |
| β-strand | 139 | 1 | 4 |
| α-helix | 141-152 | 12 | |
| α-helix | 154-156 | 3 | |
| α-helix | 161-171 | 11 | |
| α-helix | 172-177 | 6 | |
| α-helix | 178-180 | 3 | |
| α-helix | 182-194 | 13 | |
| β-strand | 198 | 1 | 4 |
| α-helix | 202-220 | 19 | |
| β-strand | 222 | 1 | 5 |
| β-strand | 225-233 | 9 | 5 |
| β-strand | 239-244 | 6 | 5 |
| α-helix | 245-248 | 4 | |
| β-strand | 255 | 1 | 3 |
| α-helix | 260-262 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ricin A chain | X | protein | 268 | Ricinus communis | P02879 (AlphaFold model) |
>4MX5_1 Ricin A chain (chains X) MIFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFIL VELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAF GGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAA RFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSK FSVYDVSILIPIIALMVYRCAPPPSSQF
| ID | Name | Formula | Copies |
|---|---|---|---|
| 5MX | benzyl (2-{[(2-amino-4-oxo-3,4-dihydropteridin-7-yl)carbonyl]amino}ethyl)carbam… | C17 H17 N7 O4 | 1 |
Sulfur incorporation generally improves Ricin inhibition in pterin-appended glycine-phenylalanine dipeptide mimics. Wiget, P.A., Manzano, L.A., Pruet, J.M. et al. Bioorg Med Chem Lett (2013) 23:6799-6804. PubMed
Other PDB entries of the same protein (UniProt P02879 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4MX5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.