4MY2: Norrin in fusion with Maltose Binding Protein

Crystal Structure of Norrin in fusion with Maltose Binding Protein. Determined by X-ray diffraction at 2.4 Å resolution. Released 13 Nov 2013.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Escherichia coli O157:H7, Homo sapiens
Chains: 1
Atoms: 3,897
Mol. weight: 53.18 kDa
Released: 13 Nov 2013

Explore 4MY2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MY2 contains 26 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
α-helix	19-33	15
α-helix	35	1
β-strand	36-40	5	1
α-helix	45-53	9
β-strand	61-65	5	1
α-helix	66-68	3
α-helix	69-74	6
β-strand	78	1	2
α-helix	85-88	4
β-strand	91	1	3
α-helix	93-98	6
β-strand	100-101	2	4
β-strand	104-105	2	4
β-strand	108-113	6	1
β-strand	116-120	5	5
β-strand	130	1	6
α-helix	135-142	8
β-strand	147-150	4	5
α-helix	156-165	10
β-strand	169-174	6	7
β-strand	177-184	8	7
α-helix	188-202	15
α-helix	212-220	9
β-strand	224-229	6	5
α-helix	231-233	3
α-helix	234-238	5
β-strand	244-247	4	5
α-helix	248-250	3
β-strand	251	1	6
β-strand	252	1	8
β-strand	255	1	8
α-helix	259	1
β-strand	260-261	2	9
β-strand	262-268	7	1
β-strand	269	1	2
α-helix	275-280	6
α-helix	281-286	6
α-helix	289-298	10
β-strand	303-304	2	1
β-strand	306	1	3
α-helix	307-313	7
α-helix	317-328	12
β-strand	330-331	2	9
α-helix	332-333	2
α-helix	338-353	16
α-helix	363-369	7
α-helix	1031-1035	5
β-strand	1040-1048	9	10
β-strand	1055	1	11
β-strand	1058-1066	9	10
α-helix	1072-1073	2
β-strand	1074-1077	4	12
α-helix	1078-1079	2
β-strand	1089-1092	4	12
β-strand	1094-1108	15	13
β-strand	1110	1	11
β-strand	1116-1130	15	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein, Norrin fusion protein	A	protein	477	Escherichia coli O157:H7, Homo sapiens	P0AEY0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MY2_1 Maltose-binding periplasmic protein, Norrin fusion protein (chains A)
MAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPD
IIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYN
KDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDI
KDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTS
KVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKP
LGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVD
EALKDAQTNAAAEFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSE
PLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

Primary citation

Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex. Ke, J., Harikumar, K.G., Erice, C. et al. Genes Dev (2013) 27:2305-2319. DOI 10.1101/gad.228544.113 · PubMed

Other PDB entries of the same protein (UniProt P0AEY0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PQP 1.07 Å, Crystal structure of maltose binding protein (Apo), mutant Trp340 to 4-Fluorotryptophan
9PQL 1.37 Å, Crystal structure of maltose binding protein (Apo), mutant Trp62 to 4-Fluorotryptophan
9PQN 1.37 Å, Crystal structure of maltose binding protein (Apo), mutant Trp340 to 4-Cyanotryptophan
9TY2 1.75 Å, Crystal structure of a Picomolar Nanobody in complex with Maltose Binding Protein, MBP,…
4WGI 1.85 Å, A Single Diastereomer of a Macrolactam Core Binds Specifically to Myeloid Cell Leukemia…
9PQK 1.87 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Fluorotryptophan
4WVI 1.9 Å, Crystal structure of the Type-I signal peptidase from Staphylococcus aureus (SpsB) in…
4WVJ 1.95 Å, Crystal structure of the Type-I signal peptidase from Staphylococcus aureus (SpsB) in…
4YS9 2.0 Å, Ataxin-3 Carboxy-Terminal Region - Crystal C1 (tetragonal)
5II4 2.0 Å, Crystal structure of red abalone VERL repeat 1 with linker at 2.0 A resolution
5JON 2.04 Å, Crystal structure of the unliganded form of HCN2 CNBD
4WVG 2.05 Å, Crystal structure of the Type-I signal peptidase from Staphylococcus aureus (SpsB).

Browse structure collections

About this viewer

MolViewer shows 4MY2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.