5II4: Red abalone VERL repeat 1 with linker

Crystal structure of red abalone VERL repeat 1 with linker at 2.0 A resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Jun 2017.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Escherichia coli O157:H7, Haliotis rufescens
Chains: 1
Atoms: 3,880
Mol. weight: 57.7 kDa
Released: 14 Jun 2017

Explore 5II4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5II4 contains 25 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	3674-3677	4	1
α-helix	3684-3698	15
β-strand	3702-3705	4	1
α-helix	3710-3718	9
β-strand	3726-3730	5	1
α-helix	3731-3733	3
α-helix	3734-3739	6
β-strand	3743	1	2
α-helix	3744-3746	3
α-helix	3750-3755	6
β-strand	3756	1	3
α-helix	3758-3763	6
β-strand	3765-3766	2	4
β-strand	3769-3770	2	4
β-strand	3773-3778	6	1
β-strand	3781-3785	5	5
β-strand	3795	1	6
α-helix	3796-3798	3
α-helix	3799-3807	9
β-strand	3812-3814	3	5
α-helix	3821-3830	10
β-strand	3834-3839	6	7
β-strand	3842-3849	8	7
α-helix	3853-3867	15
α-helix	3877-3885	9
β-strand	3889-3894	6	5
α-helix	3896-3898	3
α-helix	3899-3904	6
β-strand	3909-3912	4	5
α-helix	3913-3915	3
β-strand	3916	1	6
β-strand	3917	1	8
β-strand	3920	1	8
α-helix	3924	1
β-strand	3925-3926	2	9
β-strand	3927-3933	7	1
β-strand	3934	1	2
α-helix	3940-3946	7
α-helix	3947-3951	5
α-helix	3954-3963	10
β-strand	3968-3969	2	1
β-strand	3971	1	3
α-helix	3972-3978	7
α-helix	3982-3993	12
β-strand	3995-3996	2	9
α-helix	3997-3998	2
α-helix	4003-4019	17
α-helix	4024-4037	14
β-strand	4039-4042	4	10
β-strand	4051-4055	5	10
β-strand	4065-4072	8	11
β-strand	4075-4079	5	11
β-strand	4086-4091	6	10
α-helix	4092	1
β-strand	4104-4105	2	10
β-strand	4107-4111	5	11
β-strand	4118-4129	12	11
β-strand	4134-4144	11	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein,Vitelline envelope sperm lysin receptor	A	protein	517	Escherichia coli O157:H7, Haliotis rufescens	P0AEY0 (AlphaFold model), Q8WR62

Sequence of entity 1 (A), FASTA

>5II4_1 Maltose-binding periplasmic protein,Vitelline envelope sperm lysin receptor (chains A)
ETGHHHHHHKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVA
ATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVE
ALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKY
AAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWA
WSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLE
AVNKDKPLGAVALKSYEEELVKDPRVAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAA
SGRQTVDAALAAAQTNAAADLTLVCSDDKSKQATLISYPVTFKGHVIKDMQIFCKNGWMQ
MTRGRGINMIRIHYPQTYTSVVPGACVFRGPYSVPTQDSIEMYTVSVALLWSDGTPTYES
LECYVTKSQASNAPEPKASPTSSTPQPEAASHQQSKL

Primary citation

Structural Basis of Egg Coat-Sperm Recognition at Fertilization. Raj, I., Sadat Al Hosseini, H., Dioguardi, E. et al. Cell (2017) 169:1315-1326.e17. DOI 10.1016/j.cell.2017.05.033 · PubMed

Other PDB entries of the same protein (UniProt P0AEY0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PQP 1.07 Å, Crystal structure of maltose binding protein (Apo), mutant Trp340 to 4-Fluorotryptophan
9PQL 1.37 Å, Crystal structure of maltose binding protein (Apo), mutant Trp62 to 4-Fluorotryptophan
9PQN 1.37 Å, Crystal structure of maltose binding protein (Apo), mutant Trp340 to 4-Cyanotryptophan
9TY2 1.75 Å, Crystal structure of a Picomolar Nanobody in complex with Maltose Binding Protein, MBP,…
4WGI 1.85 Å, A Single Diastereomer of a Macrolactam Core Binds Specifically to Myeloid Cell Leukemia…
9PQK 1.87 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Fluorotryptophan
4WVI 1.9 Å, Crystal structure of the Type-I signal peptidase from Staphylococcus aureus (SpsB) in…
4WVJ 1.95 Å, Crystal structure of the Type-I signal peptidase from Staphylococcus aureus (SpsB) in…
4YS9 2.0 Å, Ataxin-3 Carboxy-Terminal Region - Crystal C1 (tetragonal)
5JON 2.04 Å, Crystal structure of the unliganded form of HCN2 CNBD
4WVG 2.05 Å, Crystal structure of the Type-I signal peptidase from Staphylococcus aureus (SpsB).
3VD8 2.07 Å, Crystal structure of human AIM2 PYD domain with MBP fusion

Browse structure collections

About this viewer

MolViewer shows 5II4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.