4N19: Peptidyl-prolyl cis-trans isomerase FKBP1A

Name: PDB 4N19: Structural basis of conformational transitions in the active site and 80 s loop in the FK506 binding protein FKBP12
Published: 2014-02-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

Structural basis of conformational transitions in the active site and 80 s loop in the FK506 binding protein FKBP12. Determined by X-ray diffraction at 1.2 Å resolution. Released 12 Feb 2014.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,064
Mol. weight: 11.97 kDa
Released: 12 Feb 2014

Explore 4N19 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N19 contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
α-helix	20	1
β-strand	21-29	9	1
β-strand	35-38	4	1
β-strand	46-49	4	1
α-helix	57-62	6
α-helix	63-65	3
β-strand	71-76	6	1
α-helix	78-80	3
β-strand	87	1	2
β-strand	91	1	2
β-strand	97-106	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase FKBP1A	A	protein	107	Homo sapiens	P62942 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4N19_1 Peptidyl-prolyl cis-trans isomerase FKBP1A (chains A)
GVQVETISPGDGRTFPKRGQTVVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWE
EGVAQMSVGQRAKLTISPDYAYGATGHPPIIPPHATLVFDVELLKLE

Primary citation

Structural basis of conformational transitions in the active site and 80's loop in the FK506-binding protein FKBP12. Mustafi, S.M., Brecher, M., Zhang, J. et al. Biochem J (2014) 458:525-536. DOI 10.1042/BJ20131429 · PubMed

Other PDB entries of the same protein (UniProt P62942 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PPN 0.92 Å, Crystal structure of FKBP12
2PPP 0.94 Å, Crystal structure of E60Q mutant of FKBP12
6YF3 1.0 Å, FKBP12 in complex with the BMP potentiator compound 10 at 1.00A resolution
6YF2 1.03 Å, FKBP12 in complex with the BMP potentiator compound 6 at 1.03A resolution
8X6P 1.05 Å, Isomerase Protein
6YF1 1.12 Å, FKBP12 in complex with the BMP potentiator compound 8 at 1.12A resolution
8CHM 1.12 Å, Human FKBP12 in complex with (1S,5S,6R)-10-((S)-(3,5-dichlorophenyl)sulfinyl)-3-(pyridin-…
8PDF 1.2 Å, FKBP12 in complex with PROTAC 6a2
9LYG 1.26 Å, Crystal structure of FKBP12 complexed with Small Molecule Anchor for Protein-201
2PPO 1.29 Å, Crystal structure of E60A mutant of FKBP12
7U8D 1.39 Å, FKBP12 mutant V55G bound to Rapa*-3Z
9DTW 1.39 Å, Co-crystal structure of the ternary complex of human FKBP12, QDPR and Compound 4

Browse structure collections

About this viewer

MolViewer shows 4N19 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.