8X6P: Isomerase Protein

Name: PDB 8X6P: Isomerase Protein
Published: 2023-12-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

Isomerase Protein. Determined by X-ray diffraction at 1.05 Å resolution. Released 20 Dec 2023.

Method: X-ray diffraction
Resolution: 1.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,109
Mol. weight: 24.13 kDa
Released: 20 Dec 2023

Explore 8X6P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8X6P contains 8 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	21	1
β-strand	22-31	10	1
β-strand	36-39	4	1
α-helix	41-43	3
β-strand	47-50	4	1
α-helix	58-64	7
α-helix	67-68	2
β-strand	72-77	6	1
α-helix	79-81	3
β-strand	88	1	2
β-strand	92	1	2
β-strand	98-107	10	1

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	3
α-helix	21	1
β-strand	22-30	9	3
β-strand	36-39	4	3
β-strand	47-50	4	3
α-helix	58-64	7
β-strand	72-77	6	3
α-helix	79-81	3
β-strand	88	1	4
β-strand	92	1	4
β-strand	98-107	10	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase FKBP1A	A, B	protein	108	Homo sapiens	P62942 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8X6P_1 Peptidyl-prolyl cis-trans isomerase FKBP1A (chains A, B)
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Primary citation

Isomerase Protein. Guven, O., Demirci, H. To be published.

Other PDB entries of the same protein (UniProt P62942 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PPN 0.92 Å, Crystal structure of FKBP12
2PPP 0.94 Å, Crystal structure of E60Q mutant of FKBP12
6YF3 1.0 Å, FKBP12 in complex with the BMP potentiator compound 10 at 1.00A resolution
6YF2 1.03 Å, FKBP12 in complex with the BMP potentiator compound 6 at 1.03A resolution
6YF1 1.12 Å, FKBP12 in complex with the BMP potentiator compound 8 at 1.12A resolution
8CHM 1.12 Å, Human FKBP12 in complex with (1S,5S,6R)-10-((S)-(3,5-dichlorophenyl)sulfinyl)-3-(pyridin-…
4N19 1.2 Å, Structural basis of conformational transitions in the active site and 80 s loop in the…
8PDF 1.2 Å, FKBP12 in complex with PROTAC 6a2
9LYG 1.26 Å, Crystal structure of FKBP12 complexed with Small Molecule Anchor for Protein-201
2PPO 1.29 Å, Crystal structure of E60A mutant of FKBP12
7U8D 1.39 Å, FKBP12 mutant V55G bound to Rapa*-3Z
9DTW 1.39 Å, Co-crystal structure of the ternary complex of human FKBP12, QDPR and Compound 4

Browse structure collections

About this viewer

MolViewer shows 8X6P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.