9BFW: Tri-complex of Compound-4, KRAS G12C, and CypA

Tri-complex of Compound-4, KRAS G12C, and CypA. Determined by X-ray diffraction at 1.2 Å resolution. Released 5 Mar 2025.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,408
Mol. weight: 38.99 kDa
Ligands: GNP, MG, BTB, A1AOM
Released: 5 Mar 2025

Explore 9BFW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BFW contains 10 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	1
α-helix	16-25	10
β-strand	38-46	9	1
β-strand	49-57	9	1
α-helix	65-72	8
β-strand	77-83	7	1
α-helix	87-91	5
α-helix	93-104	12
β-strand	111-116	6	1
α-helix	127-137	11
β-strand	141-143	3	1
α-helix	152-166	15

Chain D: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	5-12	8	2
β-strand	15-24	10	2
α-helix	30-41	12
β-strand	52	1	2
β-strand	55-57	3	2
β-strand	61-64	4	2
β-strand	83	1	3
β-strand	97-100	4	2
β-strand	108	1	3
β-strand	112-115	4	2
α-helix	120-122	3
β-strand	128-134	7	2
α-helix	136-143	8
β-strand	156-164	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GTPase KRas	A	protein	170	Homo sapiens	P01116 (AlphaFold model)
Peptidyl-prolyl cis-trans isomerase A	D	protein	166	Homo sapiens	P62937 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9BFW_1 GTPase KRas (chains A)
SMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTA
GQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSD
LPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK

Sequence of entity 2 (D), FASTA

>9BFW_2 Peptidyl-prolyl cis-trans isomerase A (chains D)
SMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPG
FMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKT
EWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1
MG	Magnesium ion	Mg	1
BTB	2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol	C8 H19 N O5	1
A1AOM	1-acetyl-N-[(2S)-1-{[(1M,8S,10R,14S,20S)-22-cyano-4-hydroxy-18,18-dimethyl-9,15…	C40 H49 N7 O7	1

Primary citation

Discovery of Elironrasib (RMC-6291), a Potent and Orally Bioavailable, RAS(ON) G12C-Selective, Covalent Tricomplex Inhibitor for the Treatment of Patients with RAS G12C-Addicted Cancers. Cregg, J., Pota, K., Tomlinson, A.C.A. et al. J Med Chem (2025) 68:6041-6063. DOI 10.1021/acs.jmedchem.4c02313 · PubMed

Other PDB entries of the same protein (UniProt P01116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IAY 0.95 Å, Structure of 10 in complex with GDP-KRAS
9IAW 1.0 Å, Structure of 5 in complex with GDP-KRAS
12XE 1.01 Å, Crystal structure of KRAS(Q61K) bound to GppNHp and ligand
8ONV 1.01 Å, KRAS-G13D in complex with BI-2493
6P0Z 1.01 Å, Crystal structure of N-acetylated KRAS (2-169) bound to GDP and Mg
9IB5 1.01 Å, Structure of 18 (BI-2493) in complex with GDP-KRAS
8AZZ 1.02 Å, KRAS-G12V in complex with BI-2865
8AZX 1.04 Å, KRAS-G12C in complex with BI-2865
8B00 1.04 Å, KRAS-G13D in complex with BI-2865
8TVK 1.04 Å, KRAS 1-169 G12C Mutant at 100k
4QL3 1.04 Å, Crystal Structure of a GDP-bound G12R Oncogenic Mutant of Human GTPase KRas
8AZV 1.05 Å, KRAS in complex with BI-2865

Browse structure collections

About this viewer

MolViewer shows 9BFW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.