Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha. Determined by X-ray diffraction at 1.95 Å resolution. Released 5 Mar 2014.
Explore 4N4G in 3D Show helices and sheets RCSB PDB PDBe
4N4G contains 11 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 155-171 | 17 | |
| α-helix | 188-191 | 4 | |
| α-helix | 198-206 | 9 | |
| α-helix | 213-231 | 19 | |
| α-helix | 236-257 | 22 | |
| α-helix | 259-267 | 9 | |
| α-helix | 272-274 | 3 | |
| α-helix | 280-282 | 3 | |
| β-strand | 283-287 | 5 | 1 |
| β-strand | 293-302 | 10 | 1 |
| β-strand | 305-310 | 6 | 1 |
| α-helix | 313-315 | 3 | |
| β-strand | 317-321 | 5 | 1 |
| α-helix | 322-324 | 3 | |
| β-strand | 325-327 | 3 | 1 |
| α-helix | 341-359 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger MYND domain-containing protein 11 | A | protein | 252 | Mus musculus | Q8R5C8 (AlphaFold model) |
>4N4G_1 Zinc finger MYND domain-containing protein 11 (chains A) MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSNKQEMGTYLRFIVSRMKERAIDLNKK GKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQAD IARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVM QKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLRE GRFWKSKNEDRG
ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression. Wen, H., Li, Y., Xi, Y. et al. Nature (2014) 508:263-268. DOI 10.1038/nature13045 · PubMed
Other PDB entries of the same protein (UniProt Q8R5C8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4N4G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.