Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.1K36me3. Determined by X-ray diffraction at 2.3 Å resolution. Released 5 Mar 2014.
Explore 4N4H in 3D Show helices and sheets RCSB PDB PDBe
4N4H contains 12 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 157-173 | 17 | |
| α-helix | 199-206 | 8 | |
| α-helix | 213-231 | 19 | |
| α-helix | 236-257 | 22 | |
| α-helix | 259-267 | 9 | |
| α-helix | 272-274 | 3 | |
| α-helix | 280-282 | 3 | |
| β-strand | 283-288 | 6 | 1 |
| β-strand | 292-301 | 10 | 1 |
| β-strand | 305-310 | 6 | 1 |
| β-strand | 317-321 | 5 | 1 |
| α-helix | 322-324 | 3 | |
| β-strand | 325-327 | 3 | 1 |
| α-helix | 332-334 | 3 | |
| β-strand | 337 | 1 | 1 |
| α-helix | 341-359 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 34 | 1 | |
| β-strand | 35 | 1 | 1 |
| α-helix | 36-38 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger MYND domain-containing protein 11 | A | protein | 252 | Mus musculus | Q8R5C8 (AlphaFold model) |
| Peptide from Histone H3.1 | B | protein | 22 | Homo sapiens | P68431 (AlphaFold model) |
>4N4H_1 Zinc finger MYND domain-containing protein 11 (chains A) MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSNKQEMGTYLRFIVSRMKERAIDLNKK GKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQAD IARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVM QKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLRE GRFWKSKNEDRG
>4N4H_2 Peptide from Histone H3.1 (chains B) ATKAARKSAPATGGVKKPHRYR
Water and common crystallization additives (PEG) are not listed.
ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression. Wen, H., Li, Y., Xi, Y. et al. Nature (2014) 508:263-268. DOI 10.1038/nature13045 · PubMed
Other PDB entries of the same protein (UniProt Q8R5C8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4N4H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.