4NFZ: Polymerase PA

Crystal structure of polymerase subunit PA N-terminal endonuclease domain from bat-derived influenza virus H17N10. Determined by X-ray diffraction at 2.7 Å resolution. Released 18 Dec 2013.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Influenza A virus
Chains: 3
Atoms: 4,927
Mol. weight: 76.68 kDa
Ligands: MN
Released: 18 Dec 2013

Explore 4NFZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NFZ contains 26 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	11-21	11
α-helix	32-49	18
β-strand	52-54	3	1
β-strand	60-62	3	1
β-strand	73-74	2	1
β-strand	76-78	3	2
α-helix	84-96	13
α-helix	100-103	4
β-strand	109-111	3	2
β-strand	116-123	8	2
α-helix	128-135	8
β-strand	144-149	6	2
β-strand	154-156	3	2
α-helix	157-159	3
α-helix	165-184	20
α-helix	188-193	6

Chain B: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	11-24	14
α-helix	32-49	18
β-strand	52-54	3	3
β-strand	60-62	3	3
β-strand	73-74	2	3
β-strand	76-78	3	4
α-helix	84-96	13
α-helix	100-103	4
β-strand	109-111	3	4
β-strand	116-123	8	4
α-helix	127-135	9
β-strand	144-149	6	4
β-strand	154-156	3	4
α-helix	157-159	3
α-helix	165-184	20
α-helix	188-194	7

Chain C: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
α-helix	11-21	11
α-helix	32-49	18
β-strand	52-54	3	5
β-strand	60-62	3	5
β-strand	73-74	2	5
β-strand	76-78	3	6
α-helix	84-96	13
β-strand	109-111	3	6
β-strand	116-123	8	6
α-helix	127-135	9
β-strand	144-149	6	6
β-strand	154-156	3	6
α-helix	157-159	3
α-helix	165-184	20
α-helix	188-194	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase PA	A, B, C	protein	214	Influenza A virus	H6QM92

Sequence of entity 1 (A, B, C), FASTA

>4NFZ_1 Polymerase PA (chains A, B, C)
MENFVRTNFNPMILERAEKTMKEYGENPQNEGNKFAAISTHMEVCFMYSDFHFIDLEGNT
IVKENDDDNAMLKHRFEIIEGQERNIAWTIVNSICNMTENSKPRFLPDLYDYKTNKFIEI
GVTRRKVEDYYYEKASKLKGENVYIHIFSFDGEEMATDDEYILDEESRARIKTRLFVLRQ
ELATAGLWDSFRQSEKGEETLEEEFSLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	3

Primary citation

The N-Terminal Domain of PA from Bat-Derived Influenza-Like Virus H17N10 Has Endonuclease Activity. Tefsen, B., Lu, G., Zhu, Y. et al. J Virol (2014) 88:1935-1941. DOI 10.1128/JVI.03270-13 · PubMed

Other PDB entries of the same protein (UniProt H6QM92), best resolution first:

9F37 1.91 Å, Replication-like initiation state of influenza polymerase with GTP and CTP at…
9F2R 1.96 Å, Influenza A/H17N10 polymerase with bound promoter and 3' end of template in active site
6SZU 2.41 Å, Bat Influenza A polymerase pre-termination complex with pyrophosphate using 44-mer vRNA…
5M3H 2.5 Å, Bat influenza A/H17N10 polymerase bound to four heptad repeats of serine 5…
6SZV 2.5 Å, Bat Influenza A polymerase elongation complex with incoming UTP analogue (core +…
6T0N 2.54 Å, Bat Influenza A polymerase pre-initiation complex
4WSB 2.65 Å, Bat Influenza A polymerase with bound vRNA promoter
6FHH 2.7 Å, Crystal structure of bat influenza A/H17N10 polymerase with viral RNA promoter bound to…
6TW1 2.7 Å, Bat Influenza A polymerase termination complex with pyrophosphate using 44-mer vRNA…
6FHI 2.8 Å, Crystal structure of bat influenza A/H17N10 polymerase with viral RNA promoter bound to…
6T0R 2.82 Å, Bat Influenza A polymerase product dissociation complex using 44-mer vRNA template with…
6EVK 2.9 Å, Crystal structure of bat influenza A/H17N10 polymerase with viral RNA promoter and cap…

Browse structure collections

About this viewer

MolViewer shows 4NFZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.