Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in CDR H1. Determined by X-ray diffraction at 1.6 Å resolution. Released 22 Oct 2014.
Explore 4NWU in 3D Show helices and sheets RCSB PDB PDBe
4NWU contains 19 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 1 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 33C-33G | 5 | |
| β-strand | 33I-39 | 7 | 2 |
| β-strand | 45-52 | 8 | 2 |
| β-strand | 56-59 | 4 | 2 |
| β-strand | 67-72 | 6 | 1 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 2 |
| β-strand | 97-100 | 4 | 3 |
| β-strand | 100E-100H | 4 | 3 |
| β-strand | 102-103 | 2 | 2 |
| β-strand | 107-111 | 5 | 2 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 4 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 5 |
| β-strand | 133-134 | 2 | 5 |
| β-strand | 137-147 | 11 | 5 |
| β-strand | 148 | 1 | 4 |
| β-strand | 153-157 | 4 | 6 |
| α-helix | 162-164 | 3 | |
| β-strand | 166 | 1 | 6 |
| β-strand | 171-173 | 3 | 5 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-178 | 2 | 5 |
| β-strand | 185-194 | 10 | 5 |
| α-helix | 195-197 | 3 | |
| β-strand | 206-212 | 7 | 6 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-225 | 7 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 7 |
| β-strand | 10-14 | 5 | 8 |
| β-strand | 19-25 | 7 | 7 |
| β-strand | 27C-27D | 2 | 9 |
| β-strand | 30-31 | 2 | 9 |
| β-strand | 33-38 | 6 | 8 |
| β-strand | 45-49 | 5 | 8 |
| β-strand | 53-54 | 2 | 8 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 7 |
| β-strand | 70-75 | 6 | 7 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 8 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 8 |
| β-strand | 102-107 | 6 | 8 |
| β-strand | 111 | 1 | 10 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 11 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 11 |
| β-strand | 140 | 1 | 10 |
| β-strand | 145-150 | 6 | 12 |
| β-strand | 153-154 | 2 | 12 |
| α-helix | 155 | 1 | |
| β-strand | 159-163 | 5 | 11 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 11 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-197 | 7 | 12 |
| β-strand | 205-210 | 6 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| APE1551 Ab Fab heavy chain | H | protein | 242 | Homo sapiens | P01857 (AlphaFold model) |
| APE1551 Ab Fab light chain | L | protein | 220 | Homo sapiens | Q8TCD0 (AlphaFold model) |
>4NWU_1 APE1551 Ab Fab heavy chain (chains H) QVQLVQSGAEVKKPGSSVKVSCKASGDTFSNYATGDTFSNYAISWVRQAPGQGFEWMGGI IPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGPEYYDYVWGSYR YNYFDYWGQGTLVTVSSGSASAPTLFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC DK
>4NWU_2 APE1551 Ab Fab light chain (chains L) DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLTWYQQKPGQPPKLLIYWASTR ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDNYPITFGQGTRLEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Nucleotide insertions and deletions complement point mutations to massively expand the diversity created by somatic hypermutation of antibodies. Bowers, P.M., Verdino, P., Wang, Z. et al. J Biol Chem (2014) 289:33557-33567. DOI 10.1074/jbc.M114.607176 · PubMed
Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4NWU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.