5U66: Stapled peptide from domain B of protein A

Modified single helix from the B-domain of protein A bound to IgG1 Fc. Determined by X-ray diffraction at 1.7 Å resolution. Released 24 May 2017.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Staphylococcus aureus, Homo sapiens
Chains: 2
Atoms: 2,112
Mol. weight: 26.9 kDa
Released: 24 May 2017

Explore 5U66 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5U66 contains 12 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	1
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-267	10	1
β-strand	274-279	6	2
β-strand	282-284	3	2
β-strand	288-289	2	1
α-helix	290-292	3
β-strand	293-294	2	1
β-strand	299-307	9	1
α-helix	310-314	5
β-strand	319-324	6	2
β-strand	332-336	5	2
α-helix	338-340	3
β-strand	344	1	3
α-helix	345-346	2
β-strand	347-351	5	4
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	4
β-strand	373	1	3
β-strand	378-383	6	5
β-strand	386-388	3	5
β-strand	391-393	3	4
α-helix	394-396	3
β-strand	397-398	2	4
β-strand	404-413	10	4
α-helix	414-418	5
β-strand	423-428	6	5
α-helix	433-435	3
β-strand	436-441	6	5

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5003-5011	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stapled peptide from domain B of protein A	B	protein	15	Staphylococcus aureus
IgG1 fc derived from CD4-fc fusion	A	protein	207	Homo sapiens	P01857 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>5U66_1 STAPLED PEPTIDE FROM DOMAIN B OF PROTEIN A (chains B)
XFNMXQQRRFYXALH

Sequence of entity 2 (A), FASTA

>5U66_2 IgG1 fc derived from CD4-fc fusion (chains A)
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE
EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSL

Primary citation

3-2-1: Structural insights from stepwise shrinkage of a three-helix Fc-binding domain to a single helix. Ultsch, M., Braisted, A., Maun, H.R. et al. Protein Eng Des Sel (2017) 30:619-625. DOI 10.1093/protein/gzx029 · PubMed

Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
5HSF 1.52 Å, 1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1.
6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
4NWU 1.6 Å, Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in…
1L6X 1.65 Å, Fc fragment of rituximab bound to a minimized version of the B-domain from protein A…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
5JIH 1.66 Å, Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
3MCL 1.7 Å, Anti-beta-amyloid antibody c706 fab in space group P21
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement
3DJ9 1.75 Å, Crystal Structure of an isolated, unglycosylated antibody CH2 domain

Browse structure collections

About this viewer

MolViewer shows 5U66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.