Crystal structure of porcine aminopeptidase-N complexed with cleaved poly-alanine. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Dec 2013.
Explore 4NZ8 in 3D Show helices and sheets RCSB PDB PDBe
4NZ8 contains 48 α-helices and 37 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 66-68 | 3 | |
| α-helix | 72-73 | 2 | |
| β-strand | 76-87 | 12 | 1 |
| β-strand | 98-109 | 12 | 1 |
| β-strand | 113-119 | 7 | 2 |
| β-strand | 124-125 | 2 | 1 |
| β-strand | 133-136 | 4 | 1 |
| α-helix | 143-144 | 2 | |
| β-strand | 145-151 | 7 | 2 |
| β-strand | 156-165 | 10 | 2 |
| β-strand | 170-180 | 11 | 1 |
| β-strand | 187-195 | 9 | 3 |
| β-strand | 198-206 | 9 | 3 |
| α-helix | 212-214 | 3 | |
| β-strand | 218 | 1 | 2 |
| β-strand | 226 | 1 | 4 |
| β-strand | 227-235 | 9 | 1 |
| β-strand | 239-242 | 4 | 3 |
| β-strand | 246 | 1 | 5 |
| β-strand | 251-252 | 2 | 1 |
| β-strand | 259-263 | 5 | 1 |
| β-strand | 264 | 1 | 5 |
| α-helix | 265-268 | 4 | |
| β-strand | 270 | 1 | 4 |
| α-helix | 272-274 | 3 | |
| β-strand | 277-280 | 4 | 3 |
| β-strand | 283-288 | 6 | 6 |
| β-strand | 294-299 | 6 | 6 |
| α-helix | 301-305 | 5 | |
| α-helix | 310-326 | 17 | |
| β-strand | 335-341 | 7 | 6 |
| β-strand | 348-349 | 2 | 6 |
| β-strand | 354-358 | 5 | 6 |
| α-helix | 359-362 | 4 | |
| α-helix | 371-386 | 16 | |
| β-strand | 390 | 1 | 7 |
| β-strand | 394-396 | 3 | 7 |
| α-helix | 399-401 | 3 | |
| α-helix | 402-420 | 19 | |
| α-helix | 426-429 | 4 | |
| α-helix | 430 | 1 | |
| α-helix | 431-435 | 5 | |
| α-helix | 436-442 | 7 | |
| α-helix | 454-456 | 3 | |
| α-helix | 460-464 | 5 | |
| α-helix | 469 | 1 | |
| α-helix | 470-474 | 5 | |
| α-helix | 475-486 | 12 | |
| α-helix | 488-502 | 15 | |
| β-strand | 505-507 | 3 | 7 |
| α-helix | 509-521 | 13 | |
| α-helix | 532-540 | 9 | |
| β-strand | 546-551 | 6 | 8 |
| β-strand | 556-561 | 6 | 8 |
| β-strand | 582-584 | 3 | 9 |
| β-strand | 586-588 | 3 | 10 |
| β-strand | 591-592 | 2 | 10 |
| β-strand | 596-598 | 3 | 9 |
| β-strand | 603-605 | 3 | 8 |
| α-helix | 607-609 | 3 | |
| β-strand | 617-619 | 3 | 10 |
| α-helix | 621-623 | 3 | |
| β-strand | 628-631 | 4 | 8 |
| α-helix | 633-645 | 13 | |
| α-helix | 647-649 | 3 | |
| α-helix | 652-667 | 16 | |
| α-helix | 673-678 | 6 | |
| α-helix | 681-685 | 5 | |
| α-helix | 689-706 | 18 | |
| α-helix | 712-733 | 22 | |
| α-helix | 744-759 | 16 | |
| α-helix | 763-777 | 15 | |
| α-helix | 787-789 | 3 | |
| α-helix | 790-800 | 11 | |
| α-helix | 803-815 | 13 | |
| α-helix | 819-829 | 11 | |
| α-helix | 835-844 | 10 | |
| α-helix | 853-855 | 3 | |
| α-helix | 856-865 | 10 | |
| α-helix | 869-880 | 12 | |
| α-helix | 881-884 | 4 | |
| α-helix | 895-903 | 9 | |
| α-helix | 909-919 | 11 | |
| α-helix | 928-930 | 3 | |
| α-helix | 931-962 | 32 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Aminopeptidase N | A | protein | 907 | Sus scrofa | P15145 (AlphaFold model) |
| CLEAVED poly-Ala | B, C | protein | 6 | Sus scrofa |
>4NZ8_1 Aminopeptidase N (chains A) SKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRFLCQEPTDVIIIHSKKL NYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGELAD DLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTALSN MPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWARPNA IAEGHGMYALNVTGPILNFFANHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYRENALL FDPQSSSISNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGADHAEPT WNLKDLIVPGDVYRVMAVDALASSHPLTTPAEEVNTPAQISEMFDSISYSKGASVIRMLS NFLTEDLFKEGLASYLHAFAYQNTTYLDLWEHLQKAVDAQTSIRLPDTVRAIMDRWTLQM GFPVITVDTKTGNISQKHFLLDSESNVTRSSAFDYLWIVPISSIKNGVMQDHYWLRDVSQ AQNDLFKTASDDWVLLNVNVTGYFQVNYDEDNWRMIQHQLQTNLSVIPVINRAQVIYDSF NLATAHMVPVTLALDNTLFLNGEKEYMPWQAALSSLSYFSLMFDRSEVYGPMKKYLRKQV EPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQCENLAKTLFDQWMSDPENN PIHPNLRSTIYCNAIAQGGQDQWDFAWGQLQQAQLVNEADKLRSALACSNEVWLLNRYLG YTLNPDLIRKQDATSTINSIASNVIGQPLAWDFVQSNWKKLFQDYGGGSFSFSNLIQGVT RRFSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENKEVVLNWFIEHS SHHHHHH
>4NZ8_2 CLEAVED poly-Ala (chains B, C) AAAAAA
Water and common crystallization additives (SO4) are not listed.
Structural basis for multifunctional roles of mammalian aminopeptidase N. Chen, L., Lin, Y.L., Peng, G. et al. Proc Natl Acad Sci U S A (2012) 109:17966-17971. DOI 10.1073/pnas.1210123109 · PubMed
Other PDB entries of the same protein (UniProt P15145 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4NZ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.