4NZD: Interleukin 21 receptor

Interleukin 21 receptor. Determined by X-ray diffraction at 2.75 Å resolution. Released 17 Dec 2014.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,498
Mol. weight: 80.6 kDa
Ligands: MAN, TLA
Released: 17 Dec 2014

Explore 4NZD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NZD contains 22 α-helices and 49 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	1
β-strand	14-18	5	1
β-strand	49-53	5	2
β-strand	58-61	4	2
β-strand	74-80	7	3
β-strand	87-94	8	3
α-helix	95-97	3
β-strand	99	1	4
α-helix	101-104	4
β-strand	105-111	7	5
β-strand	115-120	6	5
β-strand	135-143	9	6
β-strand	144	1	7
β-strand	146	1	7
α-helix	151-152	2
β-strand	153-157	5	6
β-strand	163-166	4	5
α-helix	168-170	3
β-strand	176-185	10	6
α-helix	186	1
β-strand	193	1	4
α-helix	195-201	7
β-strand	202-205	4	6
α-helix	206-208	3

Chain B: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	8
β-strand	13-18	6	8
β-strand	27-33	7	9
β-strand	39	1	9
β-strand	49-53	5	8
β-strand	58-63	6	8
β-strand	74-80	7	9
β-strand	87-94	8	9
α-helix	95-97	3
β-strand	99	1	8
α-helix	101-104	4
β-strand	105-111	7	10
β-strand	115-120	6	10
β-strand	135-143	9	11
α-helix	151-152	2
β-strand	153-157	5	11
β-strand	163-166	4	10
α-helix	168-170	3
β-strand	176-185	10	11
α-helix	186	1
β-strand	193	1	8
α-helix	197-201	5
β-strand	202-205	4	11
α-helix	206-207	2

Chain C: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	12
β-strand	14-18	5	12
β-strand	49-53	5	13
β-strand	58-61	4	13
β-strand	74-80	7	14
β-strand	87-94	8	14
α-helix	95-97	3
β-strand	99	1	15
α-helix	101-104	4
β-strand	105-111	7	16
β-strand	115-120	6	16
β-strand	135-143	9	17
α-helix	151-152	2
β-strand	153-157	5	17
β-strand	163-166	4	16
α-helix	168-170	3
β-strand	176-185	10	17
α-helix	186	1
β-strand	193	1	15
α-helix	195-201	7
β-strand	202-205	4	17
α-helix	206-208	3
α-helix	212	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-21 receptor	A, B, C	protein	219	Homo sapiens	Q9HBE5 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4NZD_1 Interleukin-21 receptor (chains A, B, C)
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATY
TCHMDVFHFMADDIFSVQITDQSGQYSQECGSFLLAESIKPAPPFDVTVTFSGQYQISWR
SDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQ
VRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MAN	alpha-D-mannopyranose	C6 H12 O6	3
TLA	L(+)-tartaric acid	C4 H6 O6	3

Water and common crystallization additives (NA, CL, EDO) are not listed.

Primary citation

Interleukin 21 receptor structure and function. Hamming, O.T., Kang, L., Siupka, P. et al. To be published.

Other PDB entries of the same protein (UniProt Q9HBE5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PLH 1.6 Å, FAB fragment complexed with C-mannosylated tryptophan peptide
7KQ7 2.2 Å, Crystal structure of IL21R in complex with an antibody Fab fragment
9E2T 2.28 Å, Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg
3TGX 2.8 Å, IL-21:IL21R complex
8ENT 2.83 Å, Interleukin-21 signaling complex with IL-21R and IL-2Rg

Browse structure collections

About this viewer

MolViewer shows 4NZD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.