4O6B: Non-structural protein 1

Dengue Type2 Virus Non-structural protein 1 (NS1) Form 1 crystal. Determined by X-ray diffraction at 3.0 Å resolution. Released 19 Feb 2014.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Dengue virus 2
Chains: 2
Atoms: 5,126
Mol. weight: 85.79 kDa
Ligands: NAG
Released: 19 Feb 2014

Explore 4O6B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4O6B contains 19 α-helices and 61 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	1
β-strand	13-22	10	1
β-strand	34-35	2	2
α-helix	39-51	13
β-strand	57	1	3
α-helix	62-81	20
β-strand	87-90	4	4
β-strand	96-97	2	5
β-strand	102	1	3
β-strand	132-135	4	4
α-helix	145-147	3
β-strand	149	1	3
β-strand	153-157	5	2
β-strand	167-171	5	2
β-strand	178	1	6
α-helix	179-180	2
β-strand	185-189	5	7
β-strand	192-196	5	7
β-strand	200-207	8	7
β-strand	209-217	9	7
β-strand	220-221	2	5
β-strand	224	1	6
β-strand	231	1	8
α-helix	245-247	3
α-helix	268-270	3
β-strand	273-277	5	7
α-helix	279-280	2
β-strand	284-287	4	9
β-strand	298-299	2	7
β-strand	301	1	10
β-strand	307	1	10
β-strand	310-313	4	9
α-helix	320	1
β-strand	321-324	4	7
β-strand	329-331	3	7
β-strand	335-337	3	9
α-helix	342-344	3
β-strand	347	1	7

Chain B: 10 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	12-22	11	1
β-strand	32-34	3	11
α-helix	39-52	14
β-strand	56-57	2	12
α-helix	62-81	20
β-strand	87-90	4	12
β-strand	96-97	2	13
β-strand	102	1	12
β-strand	132-135	4	12
α-helix	145-147	3
β-strand	148-149	2	12
β-strand	153-154	2	14
β-strand	158	1	11
β-strand	165-167	3	11
β-strand	170-171	2	14
β-strand	178	1	15
α-helix	179-180	2
α-helix	181-183	3
β-strand	185-189	5	7
β-strand	192-196	5	7
β-strand	200-207	8	7
β-strand	209-217	9	7
β-strand	220-221	2	13
β-strand	224	1	15
β-strand	231	1	8
α-helix	245-247	3
β-strand	273-277	5	7
β-strand	284-287	4	16
α-helix	292-294	3
α-helix	297	1
β-strand	298	1	17
β-strand	299	1	7
β-strand	301	1	18
β-strand	307	1	18
β-strand	310-313	4	16
α-helix	320	1
β-strand	321-324	4	7
β-strand	329-331	3	7
β-strand	336-337	2	16
α-helix	342-344	3
β-strand	347	1	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A, B	protein	376	Dengue virus 2	P29990

Sequence of entity 1 (A, B), FASTA

>4O6B_1 Non-structural protein 1 (chains A, B)
AHHHHHHSSGVDLGTENLYFQSNADSGCVVSWKNKELKCGSGIFITDNVHTWTEQYKFQP
ESPSKLASAIQKAHEEGICGIRSVTRLENLMWKQITPELNHILSENEVKLTIMTGDIKGI
MQAGKRSLRPQPTELKYSWKTWGKAKMLSTESHNQTFLIDGPETAECPNTNRAWNSLEVE
DYGFGVFTTNIWLKLKEKQDVFCDSKLMSAAIKDNRAVHADMGYWIESALNDTWKIEKAS
FIEVKNCHWPKSHTLWSNGVLESEMIIPKNLAGPVSQHNYRPGYHTQITGPWHLGKLEMD
FDFCDGTTVVVTEDCGNRGPSLRTTTASGKLITEWCCRSCTLPPLRYRGEDGCWYGMEIR
PLKEKEENLVNSLVTA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Flavivirus NS1 structures reveal surfaces for associations with membranes and the immune system. Akey, D.L., Brown, W.C., Dutta, S. et al. Science (2014) 343:881-885. DOI 10.1126/science.1247749 · PubMed

Other PDB entries of the same protein (UniProt P29990), best resolution first:

7K93 2.89 Å, DENV2 NS1 in complex with neutralizing 2B7 single chain Fab variable region (scFv)
6ZQU 3.1 Å, Cryo-EM structure of mature Dengue virus 2 at 3.1 angstrom resolution
6WY1 3.42 Å, Crystal structure of an engineered thermostable dengue virus 2 envelope protein dimer
2R69 3.8 Å, Crystal structure of Fab 1A1D-2 complexed with E-DIII of Dengue virus at 3.8 angstrom…
6WER 3.96 Å, DENV2 NS1 in complex with neutralizing 2B7 Fab fragment
3J42 21.0 Å, Obstruction of Dengue Virus Maturation by Fab Fragments of the 2H2 Antibody
3J8D 26.0 Å, Cryoelectron microscopy of dengue-Fab E104 complex at pH 5.5

Browse structure collections

About this viewer

MolViewer shows 4O6B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.