Crystal structure of an engineered thermostable dengue virus 2 envelope protein dimer. Determined by X-ray diffraction at 3.42 Å resolution. Released 10 Nov 2021.
Explore 6WY1 in 3D Show helices and sheets RCSB PDB PDBe
6WY1 contains 6 α-helices and 40 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| β-strand | 21-26 | 6 | 2 |
| β-strand | 27 | 1 | 1 |
| β-strand | 30-35 | 6 | 1 |
| β-strand | 38-49 | 12 | 1 |
| β-strand | 54-59 | 6 | 3 |
| β-strand | 60-72 | 13 | 4 |
| α-helix | 83-86 | 4 | |
| β-strand | 90-99 | 10 | 4 |
| β-strand | 109-124 | 16 | 4 |
| β-strand | 126-129 | 4 | 3 |
| β-strand | 136-143 | 8 | 1 |
| β-strand | 160-164 | 5 | 1 |
| β-strand | 165 | 1 | 5 |
| β-strand | 168 | 1 | 5 |
| β-strand | 170-171 | 2 | 2 |
| β-strand | 174-175 | 2 | 6 |
| β-strand | 179-180 | 2 | 6 |
| β-strand | 182-186 | 5 | 2 |
| β-strand | 196-200 | 5 | 3 |
| β-strand | 205-209 | 5 | 3 |
| α-helix | 210-214 | 5 | |
| β-strand | 220-222 | 3 | 3 |
| β-strand | 232 | 1 | 3 |
| α-helix | 234-237 | 4 | |
| β-strand | 238-240 | 3 | 7 |
| β-strand | 250-252 | 3 | 7 |
| β-strand | 255 | 1 | 4 |
| α-helix | 257-263 | 7 | |
| β-strand | 269-270 | 2 | 3 |
| β-strand | 272 | 1 | 8 |
| β-strand | 277 | 1 | 8 |
| β-strand | 282-288 | 7 | 2 |
| β-strand | 292 | 1 | 6 |
| α-helix | 300 | 1 | |
| β-strand | 301 | 1 | 9 |
| α-helix | 302 | 1 | |
| β-strand | 307-314 | 8 | 10 |
| β-strand | 320-325 | 6 | 10 |
| β-strand | 334 | 1 | 9 |
| β-strand | 337-340 | 4 | 11 |
| β-strand | 347 | 1 | 11 |
| β-strand | 351 | 1 | 10 |
| β-strand | 365-369 | 5 | 10 |
| β-strand | 374-380 | 7 | 11 |
| β-strand | 387-393 | 7 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dengue 2 soluble recombinant envelope | A | protein | 408 | Dengue virus 2 | P29990 |
>6WY1_1 Dengue 2 soluble recombinant envelope (chains A) MRCIGMSNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYC IEAKLTNTTTESRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCDLFGKGGIVTCAMFR CKKNMEGKVVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSITEAELTGYGT VTMECSPRTGLDFNEMVLLQMENKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTF KNPHAKKQDVVVLGSQEGWMHRALTGATEIQMSSGNLLWPGHLKCRLRMDKLQLKGMSYS MCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTE KDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSGGSHHHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Designed, highly expressing, thermostable dengue virus 2 envelope protein dimers elicit quaternary epitope antibodies. Kudlacek, S.T., Metz, S., Thiono, D. et al. Sci Adv (2021) 7:eabg4084-eabg4084. DOI 10.1126/sciadv.abg4084 · PubMed
Other PDB entries of the same protein (UniProt P29990), best resolution first:
MolViewer shows 6WY1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.