4O8Y: Zinc-free Rpn11

Zinc-free Rpn11 in complex with Rpn8. Determined by X-ray diffraction at 1.95 Å resolution. Released 22 Jan 2014.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 3,069
Mol. weight: 49.24 kDa
Released: 22 Jan 2014

Explore 4O8Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4O8Y contains 11 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
α-helix	12-24	13
β-strand	34-40	7	1
β-strand	45-53	9	1
β-strand	56-59	4	2
β-strand	62-68	7	2
α-helix	70-83	14
β-strand	88-94	7	1
α-helix	103-111	9
α-helix	118	1
β-strand	119-123	5	1
β-strand	134-142	9	1
β-strand	151-157	7	1
β-strand	159-161	3	1
α-helix	165-180	16

Chain B: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	26-30	5	3
α-helix	31-44	14
β-strand	50-59	10	3
β-strand	62-70	9	3
α-helix	71-73	3
α-helix	80-82	3
α-helix	85-96	12
β-strand	103-110	8	3
α-helix	120-132	13
β-strand	137-141	5	3
β-strand	147	1	4
β-strand	150	1	4
β-strand	153-158	6	3
β-strand	196-198	3	3
β-strand	200-204	5	3
α-helix	207-213	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
26S proteasome regulatory subunit RPN8	A	protein	185	Saccharomyces cerevisiae	Q08723 (AlphaFold model)
26S proteasome regulatory subunit RPN11	B	protein	240	Saccharomyces cerevisiae	P43588 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4O8Y_1 26S proteasome regulatory subunit RPN8 (chains A)
MGSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEED
EKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPL
LLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVL
EVLFQ

Sequence of entity 2 (B), FASTA

>4O8Y_2 26S proteasome regulatory subunit RPN11 (chains B)
GPERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVD
DYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLS
SVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGL
LNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLA

Primary citation

Structure of the Rpn11-Rpn8 dimer reveals mechanisms of substrate deubiquitination during proteasomal degradation. Worden, E.J., Padovani, C., Martin, A. Nat Struct Mol Biol (2014) 21:220-227. DOI 10.1038/nsmb.2771 · PubMed

Other PDB entries of the same protein (UniProt Q08723 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W83 1.55 Å, Rpn8/Rpn11 dimer complex
4OCM 1.99 Å, Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ib
4O8X 1.99 Å, Zinc-bound Rpn11 in complex with Rpn8
4OCN 2.25 Å, Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form II
4OWP 2.35 Å, Crystal structure of rpn11 in a heterodimer complex with rpn8, representing the active…
4OCL 2.4 Å, Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ia
5U4P 2.5 Å, Protein-protein complex between 26S proteasome regulatory subunit RPN8, RPN11, and…
3JCK 3.5 Å, Structure of the yeast 26S proteasome lid sub-complex
9CGC 3.61 Å, Yeast 26S proteasome non-substrate-engaged (S1 state)
6J2Q 3.8 Å, Yeast proteasome in Ub-accepted state (C1-b)
6J2X 3.8 Å, Yeast proteasome in resting state (C1-a)
5MPD 4.1 Å, 26S proteasome in presence of ATP (s1)

Browse structure collections

About this viewer

MolViewer shows 4O8Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.