4OCN: 26S proteasome regulatory subunit RPN8

Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form II. Determined by X-ray diffraction at 2.25 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 2.25 Å
Organisms: Saccharomyces cerevisiae, Lama glama
Chains: 6
Atoms: 7,341
Mol. weight: 120.52 kDa
Released: 29 Jan 2014

Explore 4OCN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OCN contains 29 α-helices and 63 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
α-helix	12-24	13
β-strand	34-40	7	1
β-strand	45-53	9	1
β-strand	56-59	4	2
β-strand	62-68	7	2
α-helix	70-81	12
β-strand	88-94	7	1
α-helix	103-110	8
α-helix	118	1
β-strand	119-123	5	1
β-strand	134-144	11	1
β-strand	149-157	9	1
β-strand	159-161	3	1
α-helix	165-175	11

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	26-30	5	3
α-helix	31-44	14
β-strand	50-57	8	3
β-strand	62-70	9	3
α-helix	71-73	3
α-helix	85-96	12
α-helix	102	1
β-strand	103-110	8	3
α-helix	120-130	11
β-strand	137-141	5	3
β-strand	147	1	4
β-strand	150	1	4
β-strand	153-158	6	3
β-strand	196-204	9	3
α-helix	207-213	7

Chain C: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	5
β-strand	12-15	4	6
β-strand	19-25	7	5
β-strand	34-40	7	7
β-strand	47-53	7	7
β-strand	59-61	3	7
β-strand	69-74	6	5
β-strand	79-84	6	5
α-helix	89-91	3
β-strand	93-100	8	7
α-helix	107-109	3
β-strand	112-113	2	7
β-strand	114	1	5
β-strand	117-119	3	7
β-strand	120-126	7	6

Chain D: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
α-helix	12-24	13
α-helix	27-28	2
β-strand	34-40	7	1
β-strand	45-54	10	1
β-strand	56-58	3	8
β-strand	66-68	3	8
α-helix	70-83	14
β-strand	88-94	7	1
α-helix	103-110	8
α-helix	118	1
β-strand	119-123	5	1
β-strand	134-144	11	1
β-strand	149-157	9	1
β-strand	159-161	3	1
α-helix	171-175	5

Chain E: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	26-30	5	9
α-helix	31-44	14
β-strand	50-57	8	9
β-strand	62-71	10	9
α-helix	72-73	2
α-helix	85-96	12
α-helix	102	1
β-strand	103-110	8	9
α-helix	120-132	13
β-strand	137-141	5	9
β-strand	147	1	10
β-strand	150	1	10
β-strand	153-158	6	9
β-strand	196-204	9	9
α-helix	207-213	7

Chain F: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	11
β-strand	12-14	3	12
β-strand	19-25	7	11
β-strand	34-40	7	13
α-helix	45-46	2
β-strand	47-53	7	13
β-strand	59-61	3	13
α-helix	63-65	3
β-strand	69-74	6	11
β-strand	79-84	6	11
α-helix	89-91	3
β-strand	93-100	8	13
α-helix	107-109	3
β-strand	112-113	2	13
β-strand	117-119	3	13
β-strand	120-122	3	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
26S proteasome regulatory subunit RPN8	A, D	protein	187	Saccharomyces cerevisiae	Q08723 (AlphaFold model)
26S proteasome regulatory subunit RPN11	B, E	protein	220	Saccharomyces cerevisiae	P43588 (AlphaFold model)
Nb1	C, F	protein	133	Lama glama

Sequence of entity 1 (A, D), FASTA

>4OCN_1 26S proteasome regulatory subunit RPN8 (chains A, D)
GHMSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEE
DEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNP
LLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRGS
GGSGGSG

Sequence of entity 2 (B, E), FASTA

>4OCN_2 26S proteasome regulatory subunit RPN11 (chains B, E)
MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDD
YTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSS
VDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLL
NKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQ

Sequence of entity 3 (C, F), FASTA

>4OCN_3 Nb1 (chains C, F)
MQVQLQESGGGLVPAGGSLRLSCVDSGRTFSSTVMAWFRQAPGKEREFVATIRWSGGNTY
YADSVKGRFTISRDNARNTVYLQMNSLKPEDTAVYYCAGGTYYGTLSYKYDFWGRGTQVT
VSSHHHHHHEPEA

Primary citation

Crystal structure of the proteasomal deubiquitylation module Rpn8-Rpn11. Pathare, G.R., Nagy, I., Sledz, P. et al. Proc Natl Acad Sci U S A (2014) 111:2984-2989. DOI 10.1073/pnas.1400546111 · PubMed

Other PDB entries of the same protein (UniProt Q08723 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W83 1.55 Å, Rpn8/Rpn11 dimer complex
4O8Y 1.95 Å, Zinc-free Rpn11 in complex with Rpn8
4OCM 1.99 Å, Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ib
4O8X 1.99 Å, Zinc-bound Rpn11 in complex with Rpn8
4OWP 2.35 Å, Crystal structure of rpn11 in a heterodimer complex with rpn8, representing the active…
4OCL 2.4 Å, Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ia
5U4P 2.5 Å, Protein-protein complex between 26S proteasome regulatory subunit RPN8, RPN11, and…
3JCK 3.5 Å, Structure of the yeast 26S proteasome lid sub-complex
9CGC 3.61 Å, Yeast 26S proteasome non-substrate-engaged (S1 state)
6J2Q 3.8 Å, Yeast proteasome in Ub-accepted state (C1-b)
6J2X 3.8 Å, Yeast proteasome in resting state (C1-a)
5MPD 4.1 Å, 26S proteasome in presence of ATP (s1)

Browse structure collections

About this viewer

MolViewer shows 4OCN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.