4OCN: 26S proteasome regulatory subunit RPN8
Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form II. Determined by X-ray diffraction at 2.25 Å resolution. Released 29 Jan 2014.
- Method
- X-ray diffraction
- Resolution
- 2.25 Å
- Organisms
- Saccharomyces cerevisiae, Lama glama
- Chains
- 6
- Atoms
- 7,341
- Mol. weight
- 120.52 kDa
- Released
- 29 Jan 2014
Explore 4OCN in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4OCN contains 29 α-helices and 63 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-10 | 4 | 1 |
| α-helix | 12-24 | 13 | |
| β-strand | 34-40 | 7 | 1 |
| β-strand | 45-53 | 9 | 1 |
| β-strand | 56-59 | 4 | 2 |
| β-strand | 62-68 | 7 | 2 |
| α-helix | 70-81 | 12 | |
| β-strand | 88-94 | 7 | 1 |
| α-helix | 103-110 | 8 | |
| α-helix | 118 | 1 | |
| β-strand | 119-123 | 5 | 1 |
| β-strand | 134-144 | 11 | 1 |
| β-strand | 149-157 | 9 | 1 |
| β-strand | 159-161 | 3 | 1 |
| α-helix | 165-175 | 11 | |
Chain B: 6 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 26-30 | 5 | 3 |
| α-helix | 31-44 | 14 | |
| β-strand | 50-57 | 8 | 3 |
| β-strand | 62-70 | 9 | 3 |
| α-helix | 71-73 | 3 | |
| α-helix | 85-96 | 12 | |
| α-helix | 102 | 1 | |
| β-strand | 103-110 | 8 | 3 |
| α-helix | 120-130 | 11 | |
| β-strand | 137-141 | 5 | 3 |
| β-strand | 147 | 1 | 4 |
| β-strand | 150 | 1 | 4 |
| β-strand | 153-158 | 6 | 3 |
| β-strand | 196-204 | 9 | 3 |
| α-helix | 207-213 | 7 | |
Chain C: 2 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-8 | 4 | 5 |
| β-strand | 12-15 | 4 | 6 |
| β-strand | 19-25 | 7 | 5 |
| β-strand | 34-40 | 7 | 7 |
| β-strand | 47-53 | 7 | 7 |
| β-strand | 59-61 | 3 | 7 |
| β-strand | 69-74 | 6 | 5 |
| β-strand | 79-84 | 6 | 5 |
| α-helix | 89-91 | 3 | |
| β-strand | 93-100 | 8 | 7 |
| α-helix | 107-109 | 3 | |
| β-strand | 112-113 | 2 | 7 |
| β-strand | 114 | 1 | 5 |
| β-strand | 117-119 | 3 | 7 |
| β-strand | 120-126 | 7 | 6 |
Chain D: 6 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-10 | 4 | 1 |
| α-helix | 12-24 | 13 | |
| α-helix | 27-28 | 2 | |
| β-strand | 34-40 | 7 | 1 |
| β-strand | 45-54 | 10 | 1 |
| β-strand | 56-58 | 3 | 8 |
| β-strand | 66-68 | 3 | 8 |
| α-helix | 70-83 | 14 | |
| β-strand | 88-94 | 7 | 1 |
| α-helix | 103-110 | 8 | |
| α-helix | 118 | 1 | |
| β-strand | 119-123 | 5 | 1 |
| β-strand | 134-144 | 11 | 1 |
| β-strand | 149-157 | 9 | 1 |
| β-strand | 159-161 | 3 | 1 |
| α-helix | 171-175 | 5 | |
Chain E: 6 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 26-30 | 5 | 9 |
| α-helix | 31-44 | 14 | |
| β-strand | 50-57 | 8 | 9 |
| β-strand | 62-71 | 10 | 9 |
| α-helix | 72-73 | 2 | |
| α-helix | 85-96 | 12 | |
| α-helix | 102 | 1 | |
| β-strand | 103-110 | 8 | 9 |
| α-helix | 120-132 | 13 | |
| β-strand | 137-141 | 5 | 9 |
| β-strand | 147 | 1 | 10 |
| β-strand | 150 | 1 | 10 |
| β-strand | 153-158 | 6 | 9 |
| β-strand | 196-204 | 9 | 9 |
| α-helix | 207-213 | 7 | |
Chain F: 4 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-8 | 4 | 11 |
| β-strand | 12-14 | 3 | 12 |
| β-strand | 19-25 | 7 | 11 |
| β-strand | 34-40 | 7 | 13 |
| α-helix | 45-46 | 2 | |
| β-strand | 47-53 | 7 | 13 |
| β-strand | 59-61 | 3 | 13 |
| α-helix | 63-65 | 3 | |
| β-strand | 69-74 | 6 | 11 |
| β-strand | 79-84 | 6 | 11 |
| α-helix | 89-91 | 3 | |
| β-strand | 93-100 | 8 | 13 |
| α-helix | 107-109 | 3 | |
| β-strand | 112-113 | 2 | 13 |
| β-strand | 117-119 | 3 | 13 |
| β-strand | 120-122 | 3 | 12 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 26S proteasome regulatory subunit RPN8 | A, D | protein | 187 | Saccharomyces cerevisiae | Q08723 (AlphaFold model) |
| 26S proteasome regulatory subunit RPN11 | B, E | protein | 220 | Saccharomyces cerevisiae | P43588 (AlphaFold model) |
| Nb1 | C, F | protein | 133 | Lama glama | |
Sequence of entity 1 (A, D), FASTA
>4OCN_1 26S proteasome regulatory subunit RPN8 (chains A, D)
GHMSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEE
DEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNP
LLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRGS
GGSGGSG
Sequence of entity 2 (B, E), FASTA
>4OCN_2 26S proteasome regulatory subunit RPN11 (chains B, E)
MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDD
YTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSS
VDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLL
NKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQ
Sequence of entity 3 (C, F), FASTA
>4OCN_3 Nb1 (chains C, F)
MQVQLQESGGGLVPAGGSLRLSCVDSGRTFSSTVMAWFRQAPGKEREFVATIRWSGGNTY
YADSVKGRFTISRDNARNTVYLQMNSLKPEDTAVYYCAGGTYYGTLSYKYDFWGRGTQVT
VSSHHHHHHEPEA
Primary citation
Crystal structure of the proteasomal deubiquitylation module Rpn8-Rpn11. Pathare, G.R., Nagy, I., Sledz, P. et al. Proc Natl Acad Sci U S A (2014) 111:2984-2989. DOI 10.1073/pnas.1400546111 · PubMed
Other PDB entries of the same protein (UniProt Q08723 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5W83 1.55 Å, Rpn8/Rpn11 dimer complex
- 4O8Y 1.95 Å, Zinc-free Rpn11 in complex with Rpn8
- 4OCM 1.99 Å, Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ib
- 4O8X 1.99 Å, Zinc-bound Rpn11 in complex with Rpn8
- 4OWP 2.35 Å, Crystal structure of rpn11 in a heterodimer complex with rpn8, representing the active…
- 4OCL 2.4 Å, Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ia
- 5U4P 2.5 Å, Protein-protein complex between 26S proteasome regulatory subunit RPN8, RPN11, and…
- 3JCK 3.5 Å, Structure of the yeast 26S proteasome lid sub-complex
- 9CGC 3.61 Å, Yeast 26S proteasome non-substrate-engaged (S1 state)
- 6J2Q 3.8 Å, Yeast proteasome in Ub-accepted state (C1-b)
- 6J2X 3.8 Å, Yeast proteasome in resting state (C1-a)
- 5MPD 4.1 Å, 26S proteasome in presence of ATP (s1)
Browse structure collections
About this viewer
MolViewer shows 4OCN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.