4OBE: GDP-bound Human KRas

Crystal Structure of GDP-bound Human KRas. Determined by X-ray diffraction at 1.24 Å resolution. Released 4 Jun 2014.

Method: X-ray diffraction
Resolution: 1.24 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,093
Mol. weight: 39.59 kDa
Ligands: GDP, MG
Released: 4 Jun 2014

Explore 4OBE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OBE contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
α-helix	16-25	10
β-strand	38-46	9	1
β-strand	49-57	9	1
α-helix	65-74	10
β-strand	77-83	7	1
α-helix	87-104	18
β-strand	111-116	6	1
α-helix	127-137	11
β-strand	141-143	3	1
α-helix	152-167	16

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1-9	9	2
α-helix	16-25	10
β-strand	38-46	9	2
β-strand	49-57	9	2
α-helix	65-74	10
β-strand	77-83	7	2
α-helix	87-104	18
β-strand	111-116	6	2
α-helix	127-137	11
β-strand	141-143	3	2
α-helix	152-167	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GTPase KRas	A, B	protein	170	Homo sapiens	P01116 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4OBE_1 GTPase KRas (chains A, B)
GMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA
GQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCD
LPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2
MG	Magnesium ion	Mg	2

Primary citation

In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C. Hunter, J.C., Gurbani, D., Ficarro, S.B. et al. Proc Natl Acad Sci U S A (2014) 111:8895-8900. DOI 10.1073/pnas.1404639111 · PubMed

Other PDB entries of the same protein (UniProt P01116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IAY 0.95 Å, Structure of 10 in complex with GDP-KRAS
9IAW 1.0 Å, Structure of 5 in complex with GDP-KRAS
12XE 1.01 Å, Crystal structure of KRAS(Q61K) bound to GppNHp and ligand
8ONV 1.01 Å, KRAS-G13D in complex with BI-2493
6P0Z 1.01 Å, Crystal structure of N-acetylated KRAS (2-169) bound to GDP and Mg
9IB5 1.01 Å, Structure of 18 (BI-2493) in complex with GDP-KRAS
8AZZ 1.02 Å, KRAS-G12V in complex with BI-2865
8AZX 1.04 Å, KRAS-G12C in complex with BI-2865
8B00 1.04 Å, KRAS-G13D in complex with BI-2865
8TVK 1.04 Å, KRAS 1-169 G12C Mutant at 100k
4QL3 1.04 Å, Crystal Structure of a GDP-bound G12R Oncogenic Mutant of Human GTPase KRas
8AZV 1.05 Å, KRAS in complex with BI-2865

Browse more

4OBE is part of these collections:

Kinases and cancer drug targets

About this viewer

MolViewer shows 4OBE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.