4OG6: Human menin with bound inhibitor MIV-4

Human menin with bound inhibitor MIV-4. Determined by X-ray diffraction at 1.49 Å resolution. Released 5 Mar 2014.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,310
Mol. weight: 55.96 kDa
Ligands: 2S9
Released: 5 Mar 2014

Explore 4OG6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OG6 contains 32 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	13	1	1
α-helix	16-27	12
α-helix	34-45	12
α-helix	46-50	5
β-strand	81	1	1
α-helix	83-100	18
α-helix	103-105	3
α-helix	109-111	3
α-helix	115-128	14
α-helix	143-149	7
α-helix	154-167	14
β-strand	174-177	4	2
β-strand	182-186	5	2
α-helix	188-190	3
β-strand	192-194	3	2
α-helix	203-205	3
α-helix	212-216	5
α-helix	220-225	6
β-strand	228-229	2	2
α-helix	232-241	10
β-strand	246-248	3	3
β-strand	251-252	2	3
α-helix	254-270	17
α-helix	277-289	13
α-helix	291-292	2
α-helix	296-297	2
α-helix	298-312	15
α-helix	319-330	12
α-helix	334-348	15
α-helix	358-366	9
α-helix	367-371	5
α-helix	372-384	13
α-helix	403-405	3
α-helix	407-424	18
α-helix	434-445	12
α-helix	449-452	4
β-strand	456-458	3	4
β-strand	550-552	3	4
α-helix	556-561	6
α-helix	562-566	5
α-helix	572-580	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Menin	A	protein	489	Homo sapiens	O00255 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4OG6_1 Menin (chains A)
GGSSSMGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVGL
TYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFK
DRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAE
VTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLE
LLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRD
EHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCREDEEIYKEFFEVANDVIPNL
LKEAASLLEAGSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQSLGRF
EGQVRQKVRIVSVPAPTASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQ
VQMKKQKVS

Ligands and cofactors

ID	Name	Formula	Copies
2S9	4-(3-{4-[(R)-cyclopentyl(3-fluorophenyl)hydroxymethyl]piperidin-1-yl}propoxy)be…	C27 H33 F N2 O2	1

Water and common crystallization additives (SO4, PG4, PEG, DMS) are not listed.

Primary citation

High-Affinity Small-Molecule Inhibitors of the Menin-Mixed Lineage Leukemia (MLL) Interaction Closely Mimic a Natural Protein-Protein Interaction. He, S., Senter, T.J., Pollock, J. et al. J Med Chem (2014) 57:1543-1556. DOI 10.1021/jm401868d · PubMed

Other PDB entries of the same protein (UniProt O00255 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6O5I 1.24 Å, Menin in complex with MI-3454
4GQ4 1.27 Å, Human menin with bound inhibitor MI-2-2
8VA5 1.3 Å, Menin mutant - T349M in complex with Ziftomenib (KO-539)
9C4Y 1.31 Å, Menin mutant - T349M
9C4W 1.4 Å, Menin mutant - G331R
9C4Z 1.4 Å, Menin mutant - G331D
4OG4 1.45 Å, Human menin with bound inhibitor MIV-3S
4GPQ 1.46 Å, Structural insights into inhibition of the bivalent menin-MLL interaction by small…
9C4T 1.46 Å, menin mutant M327I in complex with MLL peptide
9C4V 1.47 Å, Menin mutant G331D in complex with MLL peptide
5DB0 1.5 Å, Menin in complex with MI-352
9WN9 1.5 Å, Wild-type Menin complexed with DSP-5336

Browse structure collections

About this viewer

MolViewer shows 4OG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.