Co-Crystal Structure of MDM2 with Inhbitor Compound 46. Determined by X-ray diffraction at 1.54 Å resolution. Released 2 Apr 2014.
Explore 4OGT in 3D Show helices and sheets RCSB PDB PDBe
4OGT contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-25 | 5 | |
| β-strand | 27-30 | 4 | 1 |
| α-helix | 32-39 | 8 | |
| β-strand | 48-49 | 2 | 1 |
| α-helix | 50-63 | 14 | |
| β-strand | 74-76 | 3 | 2 |
| α-helix | 81-86 | 6 | |
| β-strand | 90-92 | 3 | 2 |
| α-helix | 96-104 | 9 | |
| β-strand | 107-109 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase Mdm2 | A | protein | 105 | Homo sapiens | Q00987 (AlphaFold model) |
>4OGT_1 E3 ubiquitin-protein ligase Mdm2 (chains A) MSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKR LYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV
| ID | Name | Formula | Copies |
|---|---|---|---|
| 2U6 | 6-{[(2R,5R,6R)-4-[(1S)-2-(tert-butylsulfonyl)-1-cyclopropylethyl]-6-(3-chloroph… | C33 H36 Cl2 N2 O6 S | 1 |
Water and common crystallization additives (SO4) are not listed.
Novel Inhibitors of the MDM2-p53 Interaction Featuring Hydrogen Bond Acceptors as Carboxylic Acid Isosteres. Gonzalez, A.Z., Li, Z., Beck, H.P. et al. J Med Chem (2014) 57:2963-2988. DOI 10.1021/jm401911v · PubMed
Other PDB entries of the same protein (UniProt Q00987 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4OGT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.