Crystal structure of T877A-AR-LBD bound with co-regulator peptide. Determined by X-ray diffraction at 3.56 Å resolution. Released 20 Aug 2014.
Explore 4OH6 in 3D Show helices and sheets RCSB PDB PDBe
4OH6 contains 13 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 672-680 | 9 | |
| α-helix | 684-686 | 3 | |
| α-helix | 697-720 | 24 | |
| α-helix | 730-757 | 28 | |
| β-strand | 762-763 | 2 | 1 |
| β-strand | 769-770 | 2 | 1 |
| α-helix | 771 | 1 | |
| α-helix | 772-777 | 6 | |
| α-helix | 781-796 | 16 | |
| α-helix | 801-811 | 11 | |
| β-strand | 815-817 | 3 | 2 |
| α-helix | 824-842 | 19 | |
| α-helix | 853-887 | 35 | |
| α-helix | 893-901 | 9 | |
| α-helix | 903-907 | 5 | |
| β-strand | 911-913 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-5 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Androgen receptor | A | protein | 250 | Homo sapiens | P10275 (AlphaFold model) |
| Protein BUD31 homolog | B | protein | 15 | Homo sapiens | P41223 (AlphaFold model) |
>4OH6_1 Androgen receptor (chains A) QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLH VDDQMAVIQYSWMGLMVFAMGWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRH LSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNP TSCSRRFYQLTKLLDSVQPIARELHQFAFDLLIKSHMVSVDFPEMMAEIISVQVPKILSG KVKPIYFHTQ
>4OH6_2 Protein BUD31 homolog (chains B) KTRYIFDLFYKRKAY
| ID | Name | Formula | Copies |
|---|---|---|---|
| HFT | Hydroxyflutamide | C11 H11 F3 N2 O4 | 1 |
Water and common crystallization additives (SO4) are not listed.
Identification of a new androgen receptor (AR) co-regulator BUD31 and related peptides to suppress wild-type and mutated AR-mediated prostate cancer growth via peptide screening and X-ray structure analysis. Hsu, C.L., Liu, J.S., Wu, P.L. et al. Mol Oncol (2014) 8:1575-1587. DOI 10.1016/j.molonc.2014.06.009 · PubMed
Other PDB entries of the same protein (UniProt P10275 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4OH6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.