4OH8: Human MST1-RASSF5 SARAH heterodimer

Crystal Structure of the human MST1-RASSF5 SARAH heterodimer. Determined by X-ray diffraction at 2.28 Å resolution. Released 23 Jul 2014.

Method: X-ray diffraction
Resolution: 2.28 Å
Organism: Homo sapiens
Chains: 2
Atoms: 784
Mol. weight: 12.64 kDa
Released: 23 Jul 2014

Explore 4OH8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OH8 contains 3 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	10-50	41

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	9-46	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 4	A	protein	51	Homo sapiens	Q13043 (AlphaFold model)
Ras association domain-containing protein 5	B	protein	55	Homo sapiens	Q8WWW0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4OH8_1 Serine/threonine-protein kinase 4 (chains A)
GSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK

Sequence of entity 2 (B), FASTA

>4OH8_2 Ras association domain-containing protein 5 (chains B)
GSEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG

Primary citation

Structural basis of the heterodimerization of the MST and RASSF SARAH domains in the Hippo signalling pathway. Hwang, E., Cheong, H.K., Mushtaq, A.U. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:1944-1953. DOI 10.1107/S139900471400947X · PubMed

Other PDB entries of the same protein (UniProt Q13043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PAV 1.9 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
4NR2 2.0 Å, Crystal structure of STK4 (MST1) SARAH domain
8A5J 2.12 Å, Crystal structure of Human STE20-like kinase 1, MST1 in complex with compound XMU-MP-1
8PAW 2.14 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
3COM 2.2 Å, Crystal structure of Mst1 kinase
5TWG 2.3 Å, human MOB1A bound to human MST1 phosphorylated T353 peptide
9VX3 2.39 Å, Crystal structure of the peptide-bound form of HisMab-1 Fv-clasp
5TWH 2.5 Å, human MOB1A bound to MST1 phosphorylated T367 peptide
7CEA 2.55 Å, Crystal structure of HUTS-4 Fv-clasp fragment
6YAT 2.58 Å, Crystal structure of STK4 (MST1) in complex with compound 6
9IIC 2.78 Å, Crystal structure of HOIP RING2-LDD in complex with STK4 KD domain
7CEB 2.89 Å, Crystal structure of alpha6beta1 integrin headpiece

Browse structure collections

About this viewer

MolViewer shows 4OH8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.