human MOB1A bound to human MST1 phosphorylated T353 peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 12 Apr 2017.
Explore 5TWG in 3D Show helices and sheets RCSB PDB PDBe
5TWG contains 14 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 24-35 | 12 | |
| α-helix | 36-38 | 3 | |
| α-helix | 41-44 | 4 | |
| α-helix | 47-48 | 2 | |
| α-helix | 53-74 | 22 | |
| α-helix | 76-78 | 3 | |
| β-strand | 87-89 | 3 | 1 |
| β-strand | 93-95 | 3 | 1 |
| β-strand | 97 | 1 | 2 |
| β-strand | 107 | 1 | 2 |
| α-helix | 111-126 | 16 | |
| α-helix | 139-141 | 3 | |
| α-helix | 144-164 | 21 | |
| α-helix | 167-172 | 6 | |
| α-helix | 176-193 | 18 | |
| α-helix | 198-201 | 4 | |
| α-helix | 202-204 | 3 | |
| α-helix | 205-210 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-7 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MOB kinase activator 1A | A | protein | 216 | Homo sapiens | Q9H8S9 (AlphaFold model) |
| T353 peptide | E | protein | 15 | Homo sapiens | Q13043 (AlphaFold model) |
>5TWG_1 MOB kinase activator 1A (chains A) MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVN TVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMT WVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLN TSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
>5TWG_2 T353 peptide (chains E) VASTMTDGANTMIEP
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
MOB1 Mediated Phospho-recognition in the Core Mammalian Hippo Pathway. Couzens, A.L., Xiong, S., Knight, J.D.R. et al. Mol Cell Proteomics (2017) 16:1098-1110. DOI 10.1074/mcp.M116.065490 · PubMed
Other PDB entries of the same protein (UniProt Q9H8S9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TWG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.