RAGE is a nucleic acid receptor that promotes inflammatory responses to DNA. Determined by X-ray diffraction at 3.1 Å resolution. Released 30 Apr 2014.
Explore 4OI8 in 3D Show helices and sheets RCSB PDB PDBe
4OI8 contains 11 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 24-29 | 6 | 1 |
| β-strand | 34-36 | 3 | 2 |
| α-helix | 37-38 | 2 | |
| β-strand | 48-55 | 8 | 1 |
| β-strand | 62-64 | 3 | 1 |
| α-helix | 71-74 | 4 | |
| β-strand | 77-78 | 2 | 2 |
| β-strand | 84-86 | 3 | 2 |
| α-helix | 91-93 | 3 | |
| β-strand | 95-102 | 8 | 1 |
| β-strand | 108-118 | 11 | 1 |
| β-strand | 119 | 1 | 3 |
| α-helix | 120-121 | 2 | |
| β-strand | 122-127 | 6 | 4 |
| β-strand | 132-134 | 3 | 5 |
| β-strand | 139-149 | 11 | 4 |
| β-strand | 150 | 1 | 3 |
| β-strand | 154-159 | 6 | 6 |
| β-strand | 162-163 | 2 | 6 |
| β-strand | 171-179 | 9 | 4 |
| β-strand | 186-194 | 9 | 4 |
| α-helix | 196-197 | 2 | |
| β-strand | 206-211 | 6 | 6 |
| β-strand | 220-221 | 2 | 6 |
| β-strand | 225 | 1 | 6 |
| β-strand | 228-230 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23 | 1 | |
| β-strand | 24-29 | 6 | 7 |
| β-strand | 34-36 | 3 | 8 |
| β-strand | 49-55 | 7 | 7 |
| β-strand | 62-64 | 3 | 7 |
| α-helix | 71-74 | 4 | |
| β-strand | 77-78 | 2 | 8 |
| β-strand | 84-86 | 3 | 8 |
| α-helix | 91-93 | 3 | |
| β-strand | 95-102 | 8 | 7 |
| β-strand | 108-118 | 11 | 7 |
| β-strand | 119 | 1 | 9 |
| α-helix | 121-124 | 4 | |
| β-strand | 125-127 | 3 | 10 |
| β-strand | 132-134 | 3 | 11 |
| β-strand | 140-149 | 10 | 10 |
| β-strand | 150 | 1 | 9 |
| β-strand | 154-159 | 6 | 12 |
| β-strand | 162-163 | 2 | 12 |
| β-strand | 172-179 | 8 | 10 |
| β-strand | 186-193 | 8 | 10 |
| α-helix | 196-197 | 2 | |
| β-strand | 206-211 | 6 | 12 |
| β-strand | 220-221 | 2 | 12 |
| β-strand | 225 | 1 | 12 |
| β-strand | 228-230 | 3 | 11 |
| α-helix | 231-234 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Advanced glycosylation end product-specific receptor | A, B | protein | 223 | Homo sapiens | Q15109 (AlphaFold model) |
| 5'-d(*cp*cp*ap*tp*gp*ap*cp*tp*gp*tp*ap*gp*gp*ap*ap*ap*cp*tp*cp*tp*ap*gp*a)-3' | E | DNA | 23 | ||
| 5'-d(*cp*tp*cp*tp*ap*gp*ap*gp*tp*tp*tp*cp*cp*tp*ap*cp*ap*gp*tp*cp*ap*tp*g)-3' | F | DNA | 23 |
>4OI8_1 Advanced glycosylation end product-specific receptor (chains A, B) GSVDAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARV LPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVP NKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPAR GGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEAAAS
>4OI8_2 5'-D(*CP*CP*AP*TP*GP*AP*CP*TP*GP*TP*AP*GP*GP*AP*AP*AP*CP*TP*CP*TP*AP*GP*A)-3' (chains E) CCATGACTGTAGGAAACTCTAGA
>4OI8_3 5'-D(*CP*TP*CP*TP*AP*GP*AP*GP*TP*TP*TP*CP*CP*TP*AP*CP*AP*GP*TP*CP*AP*TP*G)-3' (chains F) CTCTAGAGTTTCCTACAGTCATG
RAGE is a nucleic acid receptor that promotes inflammatory responses to DNA. Sirois, C.M., Jin, T., Miller, A.L. et al. J Exp Med (2013) 210:2447-2463. DOI 10.1084/jem.20120201 · PubMed
Other PDB entries of the same protein (UniProt Q15109 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4OI8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.