4OV2: Neuronal calcium sensor 1

Crystal structure of C-terminally truncated Neuronal Calcium Sensor (NCS-1) from Rattus norvegicus. Determined by X-ray diffraction at 2.6 Å resolution. Released 26 Mar 2014.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 5,245
Mol. weight: 83.17 kDa
Ligands: CA
Released: 26 Mar 2014

Explore 4OV2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OV2 contains 38 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	27-37	11
β-strand	43-44	2	1
α-helix	45-55	11
α-helix	62-72	11
β-strand	79-80	2	1
α-helix	82-89	8
α-helix	90-94	5
α-helix	97-108	12
β-strand	116-117	2	2
α-helix	118-132	15
α-helix	145-156	12
β-strand	163-164	2	2
α-helix	166-173	8

Chain B: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	12-19	8
α-helix	24-37	14
β-strand	43-44	2	3
α-helix	45-55	11
α-helix	62-72	11
β-strand	79-80	2	3
α-helix	82-89	8
α-helix	90-94	5
α-helix	97-108	12
β-strand	116-117	2	4
α-helix	118-132	15
α-helix	145-156	12
β-strand	163-164	2	4
α-helix	166-174	9

Chain C: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	13-19	7
α-helix	24-34	11
β-strand	44	1	5
α-helix	45-55	11
α-helix	62-72	11
β-strand	79	1	5
α-helix	82-94	13
α-helix	97-108	12
β-strand	116-117	2	6
α-helix	118-132	15
α-helix	145-156	12
β-strand	163-164	2	6
α-helix	166-173	8

Chain D: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	12-20	9
α-helix	24-35	12
β-strand	44	1	7
α-helix	45-55	11
α-helix	62-72	11
β-strand	79	1	7
α-helix	82-93	12
α-helix	97-108	12
β-strand	116-117	2	8
α-helix	118-128	11
α-helix	129-133	5
α-helix	145-156	12
β-strand	163-164	2	8
α-helix	166-172	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuronal calcium sensor 1	A, B, C, D	protein	179	Rattus norvegicus	P62168 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4OV2_1 Neuronal calcium sensor 1 (chains A, B, C, D)
GAMGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPF
GDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITR
NEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADP

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	12

Primary citation

Crystal structure of C-terminally truncated Neuronal Calcium Sensor (NCS-1) from Rattus norvegicus. Pandaleneni, S., Burgoyne, R., Mayans, O. et al. To be published.

Other PDB entries of the same protein (UniProt P62168 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AEQ 1.95 Å, Neuronal calcium sensor (NCS-1)from Rattus norvegicus
5AER 2.19 Å, Neuronal calcium sensor-1 (NCS-1)from Rattus norvegicus complex with D2 dopamine…
5AFP 2.3 Å, Neuronal calcium sensor-1 (NCS-1)from Rattus norvegicus complex with rhodopsin kinase…
4YRU 2.8 Å, Crystal structure of C-terminally truncated Neuronal Calcium Sensor (NCS-1) from Rattus…

Browse structure collections

About this viewer

MolViewer shows 4OV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.