4OYD: Apoptosis regulator BHRF1

Crystal structure of a computationally designed inhibitor of an Epstein-Barr viral Bcl-2 protein. Determined by X-ray diffraction at 1.8 Å resolution. Released 9 Jul 2014.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Epstein-Barr virus, synthetic construct
Chains: 4
Atoms: 4,854
Mol. weight: 64.06 kDa
Released: 9 Jul 2014

Explore 4OYD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OYD contains 29 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	5-17	13
α-helix	24-26	3
α-helix	27-35	9
α-helix	45-60	16
α-helix	62-73	12
α-helix	79-91	13
α-helix	98-117	20
α-helix	123-137	15
α-helix	138-140	3
α-helix	141-146	6
α-helix	149-153	5

Chains B and D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	3-32	30
α-helix	39-76	38
α-helix	82-116	35

Chain C: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	24-26	3
α-helix	27-35	9
α-helix	45-60	16
α-helix	62-73	12
α-helix	79-91	13
α-helix	98-117	20
α-helix	123-137	15
α-helix	138-140	3
α-helix	141-146	6
α-helix	149-153	5
α-helix	155-157	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator BHRF1	A, C	protein	158	Epstein-Barr virus	P0C6Z1
Computationally designed Inhibitor	B, D	protein	117	synthetic construct

Sequence of entity 1 (A, C), FASTA

>4OYD_1 Apoptosis regulator BHRF1 (chains A, C)
SAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIER
NSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQS
TPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNI

Sequence of entity 2 (B, D), FASTA

>4OYD_2 Computationally designed Inhibitor (chains B, D)
ADPKKVLDKAKDQAENRVRELKQKLEELYKEARKLDLTQEMRRKLELRYIAAMLMAIGDI
YNAIRQAKQEADKLKKAGLVNSQQLDELKRRLEELKEEASRKARDYGREFQLKLEYG

Primary citation

A computationally designed inhibitor of an epstein-barr viral bcl-2 protein induces apoptosis in infected cells. Procko, E., Berguig, G.Y., Shen, B.W. et al. Cell (2014) 157:1644-1656. DOI 10.1016/j.cell.2014.04.034 · PubMed

Other PDB entries of the same protein (UniProt P0C6Z1), best resolution first:

2WH6 1.5 Å, Crystal structure of anti-apoptotic BHRF1 in complex with the Bim BH3 domain

Browse structure collections

About this viewer

MolViewer shows 4OYD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.