2WH6: Anti-apoptotic BHRF1

Name: PDB 2WH6: Crystal structure of anti-apoptotic BHRF1 in complex with the Bim BH3 domain
Published: 2010-05-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Crystal structure of anti-apoptotic BHRF1 in complex with the Bim BH3 domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 26 May 2010.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: Epstein-barr virus strain ag876, HOMO SAPIENS
Chains: 2
Atoms: 1,607
Mol. weight: 24.03 kDa
Released: 26 May 2010

Explore 2WH6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WH6 contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	24-26	3
α-helix	27-35	9
α-helix	45-60	16
α-helix	62-75	14
α-helix	79-91	13
α-helix	98-117	20
α-helix	123-137	15
α-helix	138-140	3
α-helix	141-146	6
α-helix	149-152	4
α-helix	153-157	5

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	53-69	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Early antigen protein R	A	protein	173	Epstein-barr virus strain ag876	P0C6Z1
Bcl-2-like protein 11	B	protein	26	HOMO SAPIENS	O43521 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WH6_1 EARLY ANTIGEN PROTEIN R (chains A)
MGSHHHHHHSQDPMAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVV
LRYHVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAW
CMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG

Sequence of entity 2 (B), FASTA

>2WH6_2 BCL-2-LIKE PROTEIN 11 (chains B)
DMRPEIWIAQELRRIGDEFNAYYARR

Primary citation

Structural basis for apoptosis inhibition by Epstein-Barr virus BHRF1. Kvansakul, M., Wei, A.H., Fletcher, J.I. et al. PLoS Pathog (2010) 6:e1001236-e1001236. DOI 10.1371/journal.ppat.1001236 · PubMed

Other PDB entries of the same protein (UniProt P0C6Z1), best resolution first:

4OYD 1.8 Å, Crystal structure of a computationally designed inhibitor of an Epstein-Barr viral Bcl-2…

Browse structure collections

About this viewer

MolViewer shows 2WH6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.