Fifteen minutes iron loaded human H ferritin. Determined by X-ray diffraction at 1.43 Å resolution. Released 9 Sept 2015.
Explore 4OYN in 3D Show helices and sheets RCSB PDB PDBe
4OYN contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-41 | 28 | |
| α-helix | 49-76 | 28 | |
| α-helix | 86-88 | 3 | |
| α-helix | 96-123 | 28 | |
| α-helix | 127-133 | 7 | |
| α-helix | 134-138 | 5 | |
| α-helix | 139-158 | 20 | |
| α-helix | 164-173 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ferritin heavy chain | A | protein | 183 | Homo sapiens | P02794 (AlphaFold model) |
>4OYN_1 Ferritin heavy chain (chains A) MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD NES
Water and common crystallization additives (TRS, CL) are not listed.
Iron binding to human heavy-chain ferritin. Pozzi, C., Di Pisa, F., Bernacchioni, C. et al. Acta Crystallogr D Biol Crystallogr (2015) 71:1909-1920. DOI 10.1107/S1399004715013073 · PubMed
Other PDB entries of the same protein (UniProt P02794 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4OYN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.