4P0T: Human centromere protein M

Crystal structure of human centromere protein M. Determined by X-ray diffraction at 1.49 Å resolution. Released 9 Jul 2014.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,610
Mol. weight: 38.58 kDa
Released: 9 Jul 2014

Explore 4P0T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P0T contains 13 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	16-21	6	1
α-helix	25-36	12
β-strand	44-49	6	1
β-strand	65-71	7	1
α-helix	75-85	11
α-helix	90-93	4
β-strand	97-102	6	1
α-helix	111-123	13
β-strand	128-130	3	1
α-helix	136-153	18
α-helix	162-165	4

Chain B: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	16-21	6	2
α-helix	25-36	12
β-strand	44-49	6	2
β-strand	65-71	7	2
α-helix	75-85	11
α-helix	90-93	4
β-strand	97-102	6	2
α-helix	111-123	13
β-strand	128-130	3	2
α-helix	136-153	18
α-helix	162-164	3
α-helix	165-168	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centromere protein M	A, B	protein	176	Homo sapiens	Q9NSP4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4P0T_1 Centromere protein M (chains A, B)
GPLGSMSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLP
SSVNRPRIDLIVFVVNLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRH
TVVKLAHTYQSPLLYCDLEVEGFRATMAQRLVRVLQICAGHVPGVSALNLLSLLRS

Primary citation

The pseudo GTPase CENP-M drives human kinetochore assembly. Basilico, F., Maffini, S., Weir, J.R. et al. Elife (2014) 3:e02978-e02978. DOI 10.7554/eLife.02978 · PubMed

Other PDB entries of the same protein (UniProt Q9NSP4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WAU 2.2 Å, Crystal structure of CENP-M solved by native-SAD phasing
28OP 2.7 Å, Structure of the human inner kinetochore CCAN and CENP-C bound to DNA
7R5S 2.83 Å, Structure of the human CCAN bound to alpha satellite DNA
7PKN 3.2 Å, Structure of the human CCAN deltaCT complex
7XHO 3.29 Å, Structure of human inner kinetochore CCAN complex
9TAW 3.54 Å, Structure of the human inner kinetochore CCAN bound to DNA
7XHN 3.71 Å, Structure of human inner kinetochore CCAN-DNA complex
9TAX 4.5 Å, Structure of the human inner kinetochore CCAN bound to a mono-CENP-A nucleosome
7R5V 4.55 Å, Structure of the human CCAN CENP-A alpha-satellite complex
7QOO 4.6 Å, Structure of the human inner kinetochore CCAN complex
7YYH 8.9 Å, Structure of the human CCANdeltaT CENP-A alpha-satellite complex
7YWX 12.0 Å, Structure of the human CCAN CENP-A alpha-satellite complex

Browse structure collections

About this viewer

MolViewer shows 4P0T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.