4P22: N-terminal Fragments of E1

Crystal Structure of N-terminal Fragments of E1. Determined by X-ray diffraction at 2.75 Å resolution. Released 25 Feb 2015.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,848
Mol. weight: 96.92 kDa
Released: 25 Feb 2015

Explore 4P22 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P22 contains 36 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	55-62	8
β-strand	74-78	5	1
α-helix	82-93	12
β-strand	98-102	5	1
β-strand	106	1	2
α-helix	107	1
α-helix	109-112	4
α-helix	120-122	3
β-strand	126	1	2
α-helix	127-136	10
β-strand	144-147	4	1
α-helix	153-156	4
β-strand	161-164	4	1
α-helix	169-181	13
β-strand	185-192	8	1
β-strand	195-201	7	1
β-strand	206-210	5	3
β-strand	219-224	6	4
β-strand	231-234	4	4
β-strand	244-251	8	4
α-helix	257-259	3
α-helix	262-264	3
β-strand	265-269	5	4
β-strand	275-276	2	4
α-helix	284-286	3
β-strand	291-296	6	4
β-strand	297-301	5	3
α-helix	302-305	4
α-helix	306-311	6
β-strand	315	1	1
α-helix	326-343	18
α-helix	352-368	17
α-helix	380-388	9
α-helix	395-413	19
β-strand	423-427	5	1

Chain B: 19 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	55-63	9
β-strand	74-78	5	5
α-helix	82-94	13
β-strand	98-102	5	5
β-strand	106	1	6
α-helix	107	1
α-helix	109-111	3
β-strand	126	1	6
α-helix	127-137	11
β-strand	144-147	4	5
α-helix	153-157	5
β-strand	161-164	4	5
α-helix	169-182	14
β-strand	185-192	8	5
β-strand	195-201	7	5
β-strand	206-210	5	7
β-strand	218-220	3	8
β-strand	223-224	2	9
β-strand	231-233	3	9
α-helix	237-240	4
β-strand	247-251	5	8
β-strand	254	1	10
α-helix	258-261	4
α-helix	263-264	2
β-strand	265-266	2	8
β-strand	268-269	2	9
β-strand	274-276	3	9
α-helix	284-286	3
β-strand	288	1	10
β-strand	291-296	6	8
β-strand	297-301	5	7
α-helix	303-305	3
α-helix	306-311	6
α-helix	313-314	2
β-strand	315	1	5
α-helix	324-343	20
α-helix	346-348	3
α-helix	352-368	17
α-helix	380-389	10
α-helix	395-414	20
β-strand	422-427	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like modifier-activating enzyme 1	A, B	protein	446	Homo sapiens	P22314 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4P22_1 Ubiquitin-like modifier-activating enzyme 1 (chains A, B)
GPHMADLMSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEG
LYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLS
SQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQL
RVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVT
CLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVS
QVKVPKKISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNDE
DAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKAC
SGKFMPIMQWLYFDALECLPEDKEVL

Primary citation

Expression, purification, and crystal structure of N-terminal domains of human ubiquitin-activating enzyme (E1). Xie, S.T. Biosci Biotechnol Biochem (2014) 78:1542-1549. DOI 10.1080/09168451.2014.923301 · PubMed

Other PDB entries of the same protein (UniProt P22314 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DC6 3.14 Å, Crystal structure of human ubiquitin activating enzyme E1 (Uba1) in complex with ubiquitin
7PYV 3.27 Å, Crystal structure of human UBA6 in complex with the ubiquitin-like modifier FAT10
9MC5 3.29 Å, Cryo-EM structure of Human UBA1-UBE2O-Ub -Transthiolation state 3
9WD1 3.31 Å, Cryo-EM structure of Human UBA1-UBE2O-Ub -Recruitment state 3
9MC4 3.32 Å, Cryo-EM structure of Human UBA1-UBE2O-Ub -Transthiolation state 4
9MC6 3.32 Å, Cryo-EM structure of Human UBA1-UBE2O-Ub -Transthiolation state 2
9WD0 3.33 Å, Cryo-EM structure of Human UBA1-UBE2O-Ub -Recruitment state 2
9MC7 3.34 Å, Cryo-EM structure of Human UBA1-UBE2O-Ub -Recruitment state 4
9MC9 3.37 Å, Cryo-EM structure of Human UBA1-UBE2O-Ub -Transthiolation state 1
9MCB 3.42 Å, Cryo-EM structure of Human UBA1-UBE2O-Ub -Recruitment state 1

Browse structure collections

About this viewer

MolViewer shows 4P22 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.