4P39: Human C5aR antagonist C5a-A8

Crystal structure of the human C5aR antagonist C5a-A8. Determined by X-ray diffraction at 2.4 Å resolution. Released 11 Jun 2014.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,165
Mol. weight: 33.46 kDa
Released: 11 Jun 2014

Explore 4P39 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P39 contains 12 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	679-702	24
α-helix	711-715	5
α-helix	722-740	19

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	678-702	25
α-helix	711-716	6
α-helix	722-740	19

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	679-703	25
α-helix	711-716	6
α-helix	722-740	19

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	679-703	25
α-helix	711-715	5
α-helix	722-740	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5	A, B, C, D	protein	77	Homo sapiens	P01031 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4P39_1 Complement C5 (chains A, B, C, D)
GAGAAGSTLQKKIEEIAAKYKHSVVKKCCYDGARVNNDETCEQRAARISLGPRCIKAFTE
CCVVASQLRANISFKRS

Primary citation

Structural and functional characterization of human and murine C5a anaphylatoxins. Schatz-Jakobsen, J.A., Yatime, L., Larsen, C. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:1704-1717. DOI 10.1107/S139900471400844X · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 4P39 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.