4P3Z: Chlamydia pneumoniae CopN

Chlamydia pneumoniae CopN (D29 construct). Determined by X-ray diffraction at 1.77 Å resolution. Released 30 Jul 2014.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Chlamydia pneumoniae
Chains: 1
Atoms: 2,481
Mol. weight: 47.3 kDa
Released: 30 Jul 2014

Explore 4P3Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P3Z contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	96-101	6
α-helix	109-118	10
α-helix	125-135	11
α-helix	139-152	14
α-helix	158-175	18
α-helix	177-184	8
α-helix	186-196	11
α-helix	200-211	12
α-helix	217-225	9
α-helix	230-250	21
α-helix	257-293	37
α-helix	304-316	13
α-helix	322-333	12
α-helix	337-353	17
α-helix	356-358	3
α-helix	362-382	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CopN	A	protein	425	Chlamydia pneumoniae	Q9Z8L4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4P3Z_1 CopN (chains A)
MKHHHHHHPMSDYDIPTTENLYFQGAMAASGGTGGLGGTQGVNLAAVEAAAAKADAAEVV
ASQEGSEMNMIQQSQDLTNPAAATRTKKKEEKFQTLESRKKGEAGKAEKKSESTEEKPDT
DLADKYASGNSEISGQELRGLRDAIGDDASPEDILALVQEKIKDPALQSTALDYLVQTTP
PSQGKLKEALIQARNTHTEQFGRTAIGAKNILFASQEYADQLNVSPSGLRSLYLEVTGDT
HTCDQLLSMLQDRYTYQDMAIVSSFLMKGMATELKRQGPYVPSAQLQVLMTETRNLQAVL
TSYDYFESRVPILLDSLKAEGIQTPSDLNFVKVAESYHKIINDKFPTASKVEREVRNLIG
DDVDSVTGVLNLFFSALRQTSSRLFSSADKRQQLGAMIANALDAVNINNEDYPKASDFPK
PYPWS

Primary citation

Biochemical and Structural Insights into Microtubule Perturbation by CopN from Chlamydia pneumoniae. Nawrotek, A., Guimaraes, B.G., Velours, C. et al. J Biol Chem (2014) 289:25199-25210. DOI 10.1074/jbc.M114.568436 · PubMed

Other PDB entries of the same protein (UniProt Q9Z8L4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4P40 1.2 Å, Chlamydia pneumoniae CopN
4NRH 2.2 Å, CopN-Scc3 complex
6GX7 3.19 Å, Tubulin-CopN-alphaRep complex

Browse structure collections

About this viewer

MolViewer shows 4P3Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.