4P40: Chlamydia pneumoniae CopN

Chlamydia pneumoniae CopN. Determined by X-ray diffraction at 1.2 Å resolution. Released 30 Jul 2014.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Chlamydia pneumoniae
Chains: 1
Atoms: 2,793
Mol. weight: 47.18 kDa
Ligands: DMN, FOR
Released: 30 Jul 2014

Explore 4P40 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P40 contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	97-101	5
α-helix	109-118	10
α-helix	125-135	11
α-helix	139-152	14
α-helix	155-157	3
α-helix	158-175	18
α-helix	177-184	8
α-helix	186-196	11
α-helix	200-211	12
α-helix	217-225	9
α-helix	230-250	21
α-helix	257-293	37
α-helix	304-316	13
α-helix	322-333	12
α-helix	337-353	17
α-helix	362-382	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CopN	A	protein	425	Chlamydia pneumoniae	Q9Z8L4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4P40_1 CopN (chains A)
MKHHHHHHPMSDYDIPTTENLYFQGAMAASGGTGGLGGTQGVNLAAVEAAAAKADAAEVV
ASQEGSEMNMIQQSQDLTNPAAATRTKKKEEKFQTLESRKKGEAGKAEKKSESTEEKPDT
DLADKYASGNSEISGQELRGLRDAIGDDASPEDILALVQEKIKDPALQSTALDYLVQTTP
PSQGKLKEALIQARNTHTEQFGRTAIGAKNILFASQEYADQLNVSPSGLRSLYLEVTGDT
HTCDQLLSMLQDRYTYQDMAIVSSFLMKGMATELKRQGPYVPSAQLQVLMTETRNLQAVL
TSYDYFESRVPILLDSLKAEGIQTPSDLNFVKVAESYHKIINDKFPTASKVEREVRNLIG
DDVDSVTGVLNLFFSALRQTSSRLFSSADKRQQLGAMIANALDAVNINNEDYPKASDFPK
PYPWS

Ligands and cofactors

ID	Name	Formula	Copies
DMN	Dimethylamine	C2 H7 N	1
FOR	Formyl group	C H2 O	5

Water and common crystallization additives (CL, SO4) are not listed.

Primary citation

Biochemical and Structural Insights into Microtubule Perturbation by CopN from Chlamydia pneumoniae. Nawrotek, A., Guimaraes, B.G., Velours, C. et al. J Biol Chem (2014) 289:25199-25210. DOI 10.1074/jbc.M114.568436 · PubMed

Other PDB entries of the same protein (UniProt Q9Z8L4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4P3Z 1.77 Å, Chlamydia pneumoniae CopN (D29 construct)
4NRH 2.2 Å, CopN-Scc3 complex
6GX7 3.19 Å, Tubulin-CopN-alphaRep complex

Browse structure collections

About this viewer

MolViewer shows 4P40 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.