Crystal structure of Rad53 kinase domain and SCD2. Determined by X-ray diffraction at 2.59 Å resolution. Released 28 May 2014.
Explore 4PDP in 3D Show helices and sheets RCSB PDB PDBe
4PDP contains 31 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 193-196 | 4 | |
| β-strand | 197-199 | 3 | 1 |
| β-strand | 211-217 | 7 | 1 |
| β-strand | 223-229 | 7 | 1 |
| α-helix | 241-248 | 8 | |
| β-strand | 256 | 1 | 2 |
| α-helix | 257-258 | 2 | |
| β-strand | 259-264 | 6 | 1 |
| β-strand | 269-273 | 5 | 1 |
| β-strand | 280 | 1 | 2 |
| α-helix | 281-288 | 8 | |
| α-helix | 291-292 | 2 | |
| α-helix | 293-312 | 20 | |
| β-strand | 315-316 | 2 | 3 |
| α-helix | 322-324 | 3 | |
| β-strand | 325-329 | 5 | 2 |
| β-strand | 334-337 | 4 | 2 |
| β-strand | 344-345 | 2 | 3 |
| α-helix | 359-361 | 3 | |
| α-helix | 364-367 | 4 | |
| α-helix | 387-403 | 17 | |
| α-helix | 413-422 | 10 | |
| α-helix | 428-432 | 5 | |
| α-helix | 437-446 | 10 | |
| α-helix | 451-453 | 3 | |
| α-helix | 457-461 | 5 | |
| β-strand | 477-478 | 2 | 4 |
| α-helix | 484-493 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 193-195 | 3 | |
| β-strand | 197-200 | 4 | 4 |
| β-strand | 211-217 | 7 | 4 |
| β-strand | 223-228 | 6 | 4 |
| α-helix | 241-248 | 8 | |
| β-strand | 256 | 1 | 5 |
| α-helix | 257-258 | 2 | |
| β-strand | 259-264 | 6 | 4 |
| β-strand | 269-273 | 5 | 4 |
| β-strand | 280 | 1 | 5 |
| α-helix | 281-288 | 8 | |
| α-helix | 291-292 | 2 | |
| α-helix | 293-312 | 20 | |
| β-strand | 315-316 | 2 | 6 |
| α-helix | 322-324 | 3 | |
| β-strand | 325-330 | 6 | 5 |
| β-strand | 333-337 | 5 | 5 |
| β-strand | 344-345 | 2 | 6 |
| α-helix | 359-361 | 3 | |
| α-helix | 386-403 | 18 | |
| α-helix | 413-422 | 10 | |
| α-helix | 428-433 | 6 | |
| α-helix | 437-446 | 10 | |
| α-helix | 451-453 | 3 | |
| α-helix | 457-460 | 4 | |
| α-helix | 484-492 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase RAD53 | A, B | protein | 347 | Saccharomyces cerevisiae | P22216 (AlphaFold model) |
>4PDP_1 Serine/threonine-protein kinase RAD53 (chains A, B) GAMATSKIASPGLTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFS VKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFV AAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITAFGLAKV QGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGH LPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPW IKMSPLGSQSYGDFSQISLSQSLSQQKLLENMDDAQYEFVKAQRKLQ
Structural basis of Rad53 kinase activation by dimerization and activation segment exchange. Wybenga-Groot, L.E., Ho, C.S., Sweeney, F.D. et al. Cell Signal (2014) 26:1825-1836. DOI 10.1016/j.cellsig.2014.05.004 · PubMed
Other PDB entries of the same protein (UniProt P22216 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4PDP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.