Myosin VI motor domain A458E mutant in the Pi release state, space group P212121 -. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 Apr 2015.
Explore 4PJL in 3D Show helices and sheets RCSB PDB PDBe
4PJL contains 48 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15-25 | 11 | 1 |
| β-strand | 28-33 | 6 | 1 |
| β-strand | 41-43 | 3 | 1 |
| α-helix | 45-47 | 3 | |
| β-strand | 49-50 | 2 | 1 |
| β-strand | 61 | 1 | 2 |
| α-helix | 62-64 | 3 | |
| α-helix | 70-82 | 13 | |
| β-strand | 87-90 | 4 | 2 |
| β-strand | 93-97 | 5 | 2 |
| α-helix | 109-114 | 6 | |
| α-helix | 118-119 | 2 | |
| α-helix | 127-141 | 15 | |
| β-strand | 145-150 | 6 | 2 |
| α-helix | 157-172 | 16 | |
| α-helix | 177-184 | 8 | |
| α-helix | 186-193 | 8 | |
| β-strand | 194-195 | 2 | 3 |
| β-strand | 203-204 | 2 | 3 |
| β-strand | 207-214 | 8 | 2 |
| β-strand | 220-228 | 9 | 2 |
| α-helix | 233-235 | 3 | |
| β-strand | 245 | 1 | 3 |
| α-helix | 246-254 | 9 | |
| α-helix | 257-263 | 7 | |
| α-helix | 268-270 | 3 | |
| α-helix | 272-275 | 4 | |
| α-helix | 280-281 | 2 | |
| β-strand | 282 | 1 | 4 |
| α-helix | 285-288 | 4 | |
| α-helix | 293-295 | 3 | |
| α-helix | 298-303 | 6 | |
| β-strand | 306 | 1 | 4 |
| α-helix | 313-326 | 14 | |
| α-helix | 331-348 | 18 | |
| β-strand | 352-355 | 4 | 5 |
| β-strand | 361-364 | 4 | 5 |
| α-helix | 366-368 | 3 | |
| α-helix | 369-379 | 11 | |
| α-helix | 383-391 | 9 | |
| β-strand | 392-394 | 3 | 6 |
| β-strand | 408-410 | 3 | 6 |
| α-helix | 411-412 | 2 | |
| α-helix | 413-442 | 30 | |
| β-strand | 450-456 | 7 | 2 |
| α-helix | 468-484 | 17 | |
| α-helix | 485-491 | 7 | |
| α-helix | 492-498 | 7 | |
| α-helix | 503-505 | 3 | |
| α-helix | 512-519 | 8 | |
| α-helix | 525-534 | 10 | |
| α-helix | 540-550 | 11 | |
| β-strand | 557-558 | 2 | 7 |
| α-helix | 560-562 | 3 | |
| α-helix | 566-568 | 3 | |
| α-helix | 573-575 | 3 | |
| β-strand | 576-581 | 6 | 7 |
| β-strand | 584-589 | 6 | 7 |
| α-helix | 593-596 | 4 | |
| β-strand | 598 | 1 | 8 |
| α-helix | 601-602 | 2 | |
| α-helix | 603-610 | 8 | |
| α-helix | 615-620 | 6 | |
| β-strand | 642 | 1 | 8 |
| α-helix | 643-659 | 17 | |
| β-strand | 662-669 | 8 | 2 |
| α-helix | 682-691 | 10 | |
| α-helix | 698-703 | 6 | |
| β-strand | 707-710 | 4 | 9 |
| α-helix | 711-718 | 8 | |
| α-helix | 719-721 | 3 | |
| α-helix | 724-727 | 4 | |
| α-helix | 731-741 | 11 | |
| β-strand | 749-751 | 3 | 9 |
| β-strand | 755-758 | 4 | 9 |
| α-helix | 763-770 | 8 | |
| α-helix | 774-788 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Unconventional myosin-VI | A | protein | 788 | Sus scrofa | F1RQI7 (AlphaFold model) |
>4PJL_1 Unconventional myosin-VI (chains A) EDGKPVWAPHPTDGFQVGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVED NCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQGKSLG TMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDR IVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKE ERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYL KAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGG CNLKNKSTQALEYCAELLGLDQDDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARD ALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIEGFEYFEHNSFEQFCINYCNEKLQ QFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEARLVGILDILDEENRLPQPSDQ HFTSAVHQKHKDHFRLSIPRKSKLAIHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDAL HMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRST GASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKY MPDKLARLDPRLFCKALFKALGLNEIDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELV KRVNHWLI
Water and common crystallization additives (GOL) are not listed.
How actin initiates the motor activity of Myosin. Llinas, P., Isabet, T., Song, L. et al. Dev Cell (2015) 33:401-412. DOI 10.1016/j.devcel.2015.03.025 · PubMed
Other PDB entries of the same protein (UniProt F1RQI7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4PJL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.