4PLI: Chromodomain of MRG2

Structure of the chromodomain of MRG2 in complex with H3K36me3. Determined by X-ray diffraction at 1.65 Å resolution. Released 22 Jul 2015.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Arabidopsis thaliana
Chains: 4
Atoms: 1,148
Mol. weight: 20.76 kDa
Released: 22 Jul 2015

Explore 4PLI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PLI contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	57-62	6	1
β-strand	65-77	13	1
β-strand	80-87	8	1
α-helix	92-94	3
β-strand	96-99	4	1
α-helix	100-102	3
β-strand	103-104	2	1

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	57-62	6	1
β-strand	65-77	13	1
β-strand	80-87	8	1
α-helix	92-94	3
β-strand	96-99	4	1
α-helix	100-102	3
β-strand	103-105	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
At1g02740	A, B	protein	75	Arabidopsis thaliana	Q4V3E2 (AlphaFold model)
H3K36me3	C, D	protein	11	Arabidopsis thaliana	P59169 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4PLI_1 At1g02740 (chains A, B)
GSHFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKHSD
ENIEKQKEQGLKQQG

Sequence of entity 2 (C, D), FASTA

>4PLI_2 H3K36me3 (chains C, D)
ATGGVKKPHRY

Primary citation

Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression. Bu, Z., Yu, Y., Li, Z. et al. PLoS Genet (2014) 10:e1004617-e1004617. DOI 10.1371/journal.pgen.1004617 · PubMed

Other PDB entries of the same protein (UniProt Q4V3E2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PL6 1.68 Å, Structure of the chromodomain of MRG2 in complex with H3K4me3
4PLL 2.6 Å, Structure of the chromodaomain of MRG2 in complex with H3K36me3

Browse structure collections

About this viewer

MolViewer shows 4PLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.