Crystal structure of the human TYK2 FERM and SH2 domains with an IFNAR1 intracellular peptide. Determined by X-ray diffraction at 1.99 Å resolution. Released 2 Apr 2014.
Explore 4PO6 in 3D Show helices and sheets RCSB PDB PDBe
4PO6 contains 22 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-31 | 4 | 1 |
| β-strand | 43-46 | 4 | 1 |
| β-strand | 50-52 | 3 | 2 |
| α-helix | 53-64 | 12 | |
| α-helix | 68-73 | 6 | |
| β-strand | 74-78 | 5 | 1 |
| β-strand | 83-85 | 3 | 1 |
| α-helix | 86 | 1 | |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 101-105 | 5 | 1 |
| β-strand | 122-124 | 3 | 3 |
| α-helix | 125-128 | 4 | |
| α-helix | 146-161 | 16 | |
| α-helix | 167-169 | 3 | |
| α-helix | 173-198 | 26 | |
| α-helix | 202-208 | 7 | |
| α-helix | 211-213 | 3 | |
| α-helix | 217-225 | 9 | |
| α-helix | 228-243 | 16 | |
| α-helix | 252-266 | 15 | |
| β-strand | 273-277 | 5 | 4 |
| β-strand | 279-284 | 6 | 5 |
| α-helix | 285-287 | 3 | |
| β-strand | 314-319 | 6 | 4 |
| β-strand | 323-328 | 6 | 4 |
| α-helix | 374 | 1 | |
| β-strand | 375-378 | 4 | 4 |
| α-helix | 380-382 | 3 | |
| β-strand | 383-389 | 7 | 5 |
| β-strand | 392-397 | 6 | 5 |
| β-strand | 401-406 | 6 | 5 |
| α-helix | 410-427 | 18 | |
| α-helix | 436-438 | 3 | |
| α-helix | 441-449 | 9 | |
| β-strand | 452 | 1 | 6 |
| α-helix | 457-464 | 8 | |
| β-strand | 470-475 | 6 | 6 |
| β-strand | 483-492 | 10 | 6 |
| β-strand | 498-508 | 11 | 6 |
| β-strand | 514 | 1 | 7 |
| β-strand | 515-516 | 2 | 6 |
| β-strand | 523 | 1 | 7 |
| α-helix | 526-533 | 8 | |
| β-strand | 537-540 | 4 | 8 |
| β-strand | 543-546 | 4 | 8 |
| β-strand | 549-550 | 2 | 6 |
| β-strand | 563-565 | 3 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 492-494 | 3 | |
| α-helix | 496-498 | 3 | |
| β-strand | 504-505 | 2 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Non-receptor tyrosine-protein kinase TYK2 | A | protein | 567 | Homo sapiens | P29597 (AlphaFold model) |
| Interferon alpha/beta receptor 1 | B | protein | 34 | Homo sapiens | P17181 (AlphaFold model) |
>4PO6_1 Non-receptor tyrosine-protein kinase TYK2 (chains A) GSAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHIAHKVGITPPCFNLFALFDAQ AQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREPAVYRCGPPGTEASSDQTAQG MQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFKNESLGMAFLHLCHLALRHGI PLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRRFLRDFQPGRLSQQMVMVKYL ATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTG TGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWAYFCDF RDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLVDGYFRLTADSSHYLCHEVAP PRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHPYRLILTVAQRSQAPDGMQSL RLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRAGDDCFSLRRCCLPQPGETSN LIIMRGARASPRTLNLSQLSFHRGSGS
>4PO6_2 Interferon alpha/beta receptor 1 (chains B) GSGSIDEYFSEQPLKNLLLSTSEEQIEKCFIIEN
Structural basis of IFN receptor recognition by TYK2. Wallweber, H.J.A., Tam, C., Franke, Y. et al. Nat Struct Mol Biol (2014).
Other PDB entries of the same protein (UniProt P29597 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4PO6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.