4PT5: Papain-like protease

Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus. Determined by X-ray diffraction at 2.59 Å resolution. Released 21 May 2014.

Method: X-ray diffraction
Resolution: 2.59 Å
Organism: Human betacoronavirus 2c EMC/2012
Chains: 1
Atoms: 2,526
Mol. weight: 36.1 kDa
Ligands: ZN
Released: 21 May 2014

Explore 4PT5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PT5 contains 13 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	1
β-strand	18-23	6	1
α-helix	28-31	4
β-strand	35-37	3	1
β-strand	40-41	2	1
β-strand	55-58	4	1
α-helix	64-74	11
α-helix	81-91	11
α-helix	92-94	3
β-strand	97-99	3	2
β-strand	104-106	3	2
α-helix	107-108	2
α-helix	113-122	10
β-strand	128-130	3	3
α-helix	133-144	12
α-helix	148-157	10
α-helix	160-161	2
α-helix	168-176	9
β-strand	179-181	3	3
β-strand	186-193	8	4
β-strand	197-203	7	4
α-helix	206-209	4
β-strand	210-212	3	5
α-helix	217-220	4
α-helix	223	1
β-strand	224-227	4	4
β-strand	233-242	10	4
β-strand	245-258	14	5
β-strand	267-271	5	5
β-strand	281-287	7	5
β-strand	290-295	6	5
β-strand	298-302	5	5
β-strand	304-315	12	5
β-strand	318-320	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Papain-like protease	A	protein	324	Human betacoronavirus 2c EMC/2012	K4LC41 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4PT5_1 Papain-like protease (chains A)
GPQLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLAD
NLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIM
TLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAE
LCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVE
HTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVS
KTSDWKCKVTDVLFPGQKYSSDCN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus. Lei, H., Santarsiero, B.D., Lee, H. et al. To be published.

Other PDB entries of the same protein (UniProt K4LC41 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YNM 1.68 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAM and m7GpppA
5YNF 1.79 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to m7GpppA
4RNA 1.79 Å, Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus
5YNN 1.86 Å, Crystal structure of MERS-CoV nsp16/nsp10complex bound to sinefungin and m7GpppG
5YN6 1.95 Å, Crystal structure of MERS-CoV nsp10/nsp16 complex bound to SAM
5YNQ 1.96 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAH and m7GpppG
5YN5 1.96 Å, Crystal structure of MERS-CoV nsp10/nsp16 complex
5YNO 1.96 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAH and m7GpppA
5YN8 1.97 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAH
5YNB 1.98 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to Sinefungin
5YNJ 2.04 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to m7GpppG
5YNI 2.07 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAM and m7GpppG

Browse structure collections

About this viewer

MolViewer shows 4PT5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.