Crystal structure of MERS-CoV nsp16/nsp10 complex bound to Sinefungin. Determined by X-ray diffraction at 1.98 Å resolution. Released 5 Dec 2018.
Explore 5YNB in 3D Show helices and sheets RCSB PDB PDBe
5YNB contains 22 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-5 | 4 | |
| β-strand | 8-10 | 3 | 1 |
| α-helix | 13-16 | 4 | |
| α-helix | 42-54 | 13 | |
| β-strand | 66-70 | 5 | 1 |
| β-strand | 78 | 1 | 2 |
| α-helix | 80-88 | 9 | |
| β-strand | 94-99 | 6 | 1 |
| β-strand | 104 | 1 | 2 |
| β-strand | 109-112 | 4 | 1 |
| α-helix | 115-117 | 3 | |
| β-strand | 118-120 | 3 | 3 |
| β-strand | 124-129 | 6 | 1 |
| α-helix | 144-146 | 3 | |
| α-helix | 150-159 | 10 | |
| β-strand | 161-162 | 2 | 1 |
| β-strand | 163 | 1 | 4 |
| β-strand | 164-171 | 8 | 1 |
| α-helix | 178-183 | 6 | |
| α-helix | 184-186 | 3 | |
| β-strand | 187-195 | 9 | 1 |
| β-strand | 204-211 | 8 | 1 |
| α-helix | 221-234 | 14 | |
| α-helix | 242-244 | 3 | |
| α-helix | 252-253 | 2 | |
| β-strand | 259-260 | 2 | 4 |
| α-helix | 264-266 | 3 | |
| α-helix | 269-276 | 8 | |
| β-strand | 281-282 | 2 | 4 |
| β-strand | 290-292 | 3 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-16 | 6 | |
| α-helix | 23-32 | 10 | |
| α-helix | 35-38 | 4 | |
| β-strand | 43 | 1 | 5 |
| α-helix | 44-45 | 2 | |
| β-strand | 55-56 | 2 | 5 |
| β-strand | 65-69 | 5 | 5 |
| α-helix | 71-73 | 3 | |
| α-helix | 75-79 | 5 | |
| β-strand | 96-100 | 5 | 5 |
| α-helix | 101-103 | 3 | |
| α-helix | 107-113 | 7 | |
| β-strand | 116 | 1 | 6 |
| β-strand | 123-124 | 2 | 6 |
| β-strand | 126-128 | 3 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| nsp16 protein | A | protein | 303 | Human betacoronavirus 2c EMC/2012 | K0BWD0 (AlphaFold model) |
| nsp10 protein | B | protein | 140 | Human betacoronavirus 2c EMC/2012 | K4LC41 (AlphaFold model) |
>5YNB_1 nsp16 protein (chains A) ASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLA VPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRV GQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVEL YELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLS TYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDVLVNTYR KLR
>5YNB_2 nsp10 protein (chains B) AGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNCVKMLTPKTGTGIAISVKPE STADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQIPAQCVRDPVGFCLSNTPCNVC QYWIGYGCNCDSLRQAALPQ
Structural insights into the molecular mechanism of MERS Coronavirus RNA ribose 2'-O-methylation by nsp16/nsp10 protein complex. Wei, S.M., Yang, L., Ke, Z.H. et al. To be published.
Other PDB entries of the same protein (UniProt K0BWD0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YNB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.