Crystal structure of Fab DX-2930. Determined by X-ray diffraction at 1.75 Å resolution. Released 9 Jul 2014.
Explore 4PUB in 3D Show helices and sheets RCSB PDB PDBe
4PUB contains 16 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 11-12 | 2 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 32-39 | 8 | 3 |
| β-strand | 46-51 | 6 | 3 |
| β-strand | 58-60 | 3 | 3 |
| β-strand | 68-73 | 6 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-100 | 9 | 3 |
| β-strand | 110-112 | 3 | 3 |
| β-strand | 116-118 | 3 | 3 |
| β-strand | 119-120 | 2 | 2 |
| β-strand | 126 | 1 | 4 |
| α-helix | 127-128 | 2 | |
| β-strand | 129-133 | 5 | 5 |
| α-helix | 137-139 | 3 | |
| β-strand | 140-141 | 2 | 5 |
| β-strand | 144-154 | 11 | 5 |
| β-strand | 155 | 1 | 4 |
| β-strand | 160-163 | 4 | 6 |
| α-helix | 164-166 | 3 | |
| β-strand | 172-174 | 3 | 5 |
| α-helix | 175-177 | 3 | |
| β-strand | 178-179 | 2 | 5 |
| β-strand | 185-194 | 10 | 5 |
| α-helix | 195-197 | 3 | |
| β-strand | 204-209 | 6 | 6 |
| α-helix | 210-212 | 3 | |
| β-strand | 214-219 | 6 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 7 |
| β-strand | 10-13 | 4 | 8 |
| β-strand | 19-25 | 7 | 7 |
| β-strand | 33-38 | 6 | 8 |
| β-strand | 45-49 | 5 | 8 |
| β-strand | 53-54 | 2 | 8 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 7 |
| β-strand | 70-75 | 6 | 7 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 8 |
| β-strand | 96-97 | 2 | 8 |
| β-strand | 101-105 | 5 | 8 |
| β-strand | 110 | 1 | 9 |
| α-helix | 111-112 | 2 | |
| β-strand | 113-117 | 5 | 10 |
| α-helix | 118-120 | 3 | |
| α-helix | 121-125 | 5 | |
| β-strand | 128-138 | 11 | 10 |
| β-strand | 139 | 1 | 9 |
| β-strand | 144-149 | 6 | 11 |
| β-strand | 152-153 | 2 | 11 |
| α-helix | 154 | 1 | |
| β-strand | 158-162 | 5 | 10 |
| α-helix | 163-166 | 4 | |
| β-strand | 172-181 | 10 | 10 |
| α-helix | 182-186 | 5 | |
| β-strand | 190-196 | 7 | 11 |
| β-strand | 204-209 | 6 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dx-2930 heavy chain | H | protein | 225 | Homo sapiens | S6C4R2 (AlphaFold model) |
| Dx-2930 light chain | L | protein | 213 | Homo sapiens | Q7Z3Y4 (AlphaFold model) |
>4PUB_1 DX-2930 HEAVY CHAIN (chains H) EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITVY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTMVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
>4PUB_2 DX-2930 LIGHT CHAIN (chains L) DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPS RFSGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Inhibition of plasma kallikrein by a highly specific active site blocking antibody. Kenniston, J.A., Faucette, R.R., Martik, D. et al. J Biol Chem (2014) 289:23596-23608. DOI 10.1074/jbc.M114.569061 · PubMed
Other PDB entries of the same protein (UniProt S6C4R2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4PUB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.