Mutations Outside the Active Site of HIV-1 Protease Alter Enzyme Structure and Dynamic Ensemble of the Active Site to Confer Drug Resistance. Determined by X-ray diffraction at 1.5 Å resolution. Released 18 Feb 2015.
Explore 4Q1Y in 3D Show helices and sheets RCSB PDB PDBe
4Q1Y contains 2 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 2 |
| β-strand | 18-24 | 7 | 2 |
| β-strand | 31-33 | 3 | 2 |
| β-strand | 43-49 | 7 | 2 |
| β-strand | 52-66 | 15 | 2 |
| β-strand | 69-77 | 9 | 2 |
| β-strand | 84-85 | 2 | 2 |
| α-helix | 87-90 | 4 | |
| β-strand | 96-98 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-14 | 5 | 3 |
| β-strand | 19-24 | 6 | 3 |
| β-strand | 31-33 | 3 | 3 |
| β-strand | 43-49 | 7 | 3 |
| β-strand | 52-66 | 15 | 3 |
| β-strand | 69-77 | 9 | 3 |
| β-strand | 84-85 | 2 | 3 |
| α-helix | 87-90 | 4 | |
| β-strand | 96-98 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| aspartyl protease | A, B | protein | 99 | Human immunodeficiency virus 1 | P04585 (AlphaFold model) |
>4Q1Y_1 aspartyl protease (chains A, B) PQITLWKRPLVTIRIGGQLKEALLDTGADDTIFEEMNLPGKWKPKMIGGIGGFIKVRQYD QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 3 |
| 017 | (3R,3AS,6AR)-HEXAHYDROFURO[2,3-b]furan-3-YL(1S,2R)-3-[[(4-aminophenyl)sulfonyl]… | C27 H37 N3 O7 S | 1 |
Water and common crystallization additives (ACT) are not listed.
Drug resistance conferred by mutations outside the active site through alterations in the dynamic and structural ensemble of HIV-1 protease. Ragland, D.A., Nalivaika, E.A., Nalam, M.N. et al. J Am Chem Soc (2014) 136:11956-11963. DOI 10.1021/ja504096m · PubMed
Other PDB entries of the same protein (UniProt P04585 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Q1Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.