Crystal Structure of human Focal Adhesion Kinase (Fak) bound to Compound1 (3,5-DIHYDRO[1,2,4]TRIAZINO[3,4-C][1,4]BENZOXAZIN-2(1H)-ONE). Determined by X-ray diffraction at 2.07 Å resolution. Released 2 Jul 2014.
Explore 4Q9S in 3D Show helices and sheets RCSB PDB PDBe
4Q9S contains 18 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 416 | 1 | 1 |
| α-helix | 419-421 | 3 | |
| β-strand | 422-430 | 9 | 1 |
| β-strand | 435-441 | 7 | 1 |
| β-strand | 449-455 | 7 | 1 |
| α-helix | 462-476 | 15 | |
| β-strand | 483 | 1 | 2 |
| α-helix | 484-485 | 2 | |
| β-strand | 486-490 | 5 | 1 |
| α-helix | 495 | 1 | |
| β-strand | 496-500 | 5 | 1 |
| β-strand | 505-506 | 2 | 2 |
| α-helix | 507-513 | 7 | |
| α-helix | 520-539 | 20 | |
| α-helix | 549-551 | 3 | |
| β-strand | 552-556 | 5 | 2 |
| β-strand | 559-562 | 4 | 2 |
| α-helix | 586-588 | 3 | |
| α-helix | 591-596 | 6 | |
| α-helix | 601-616 | 16 | |
| α-helix | 620-621 | 2 | |
| α-helix | 628-630 | 3 | |
| α-helix | 631-636 | 6 | |
| α-helix | 641-644 | 4 | |
| α-helix | 649-658 | 10 | |
| α-helix | 663-665 | 3 | |
| α-helix | 667-668 | 2 | |
| α-helix | 669-685 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Focal adhesion kinase 1 | A | protein | 281 | Homo sapiens | Q05397 (AlphaFold model) |
>4Q9S_1 Focal adhesion kinase 1 (chains A) GAMGSSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVR EKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLIL YAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLP IKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPP NCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| 30G | 3,5-dihydro[1,2,4]triazino[3,4-c][1,4]benzoxazin-2(1H)-one | C10 H9 N3 O2 | 1 |
Discovery of Selective and Orally Bioavailable Protein Kinase C theta (PKC theta ) Inhibitors from a Fragment Hit. George, D.M., Breinlinger, E.C., Friedman, M. et al. J Med Chem (2015) 58:222-236. DOI 10.1021/jm500669m · PubMed
Other PDB entries of the same protein (UniProt Q05397 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Q9S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.