I2 (unbound) from CH103 Lineage. Determined by X-ray diffraction at 3.0 Å resolution. Released 11 Jun 2014.
Explore 4QHN in 3D Show helices and sheets RCSB PDB PDBe
4QHN contains 10 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-7 | 3 | 1 |
| β-strand | 11-13 | 3 | 2 |
| β-strand | 17-23 | 7 | 1 |
| β-strand | 32-40 | 9 | 3 |
| β-strand | 44-51 | 8 | 3 |
| β-strand | 57-59 | 3 | 3 |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82A | 7 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 3 |
| β-strand | 101 | 1 | 3 |
| β-strand | 107-109 | 3 | 3 |
| β-strand | 110-112 | 3 | 2 |
| β-strand | 117 | 1 | 4 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-127 | 8 | 5 |
| β-strand | 136-145 | 10 | 5 |
| β-strand | 146 | 1 | 4 |
| β-strand | 151-154 | 4 | 6 |
| α-helix | 155-157 | 3 | |
| β-strand | 163-165 | 3 | 5 |
| β-strand | 176-184 | 9 | 5 |
| β-strand | 195-200 | 6 | 6 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-210 | 6 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 7 |
| β-strand | 9-11 | 2 | 8 |
| β-strand | 19-23 | 5 | 9 |
| β-strand | 34-38 | 5 | 8 |
| β-strand | 45-48 | 4 | 8 |
| β-strand | 49 | 1 | 10 |
| β-strand | 53 | 1 | 10 |
| β-strand | 62-63 | 2 | 9 |
| β-strand | 66 | 1 | 9 |
| β-strand | 71-75 | 5 | 9 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-92 | 9 | 8 |
| β-strand | 95A-98 | 4 | 8 |
| β-strand | 99 | 1 | 7 |
| β-strand | 102-104 | 3 | 8 |
| β-strand | 111 | 1 | 11 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 12 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 130-139 | 10 | 12 |
| β-strand | 140 | 1 | 11 |
| β-strand | 144-150 | 7 | 13 |
| β-strand | 153-155 | 3 | 13 |
| β-strand | 159-161 | 3 | 12 |
| α-helix | 162-164 | 3 | |
| β-strand | 165-166 | 2 | 12 |
| β-strand | 172-180 | 9 | 12 |
| α-helix | 182-187 | 6 | |
| β-strand | 191-197 | 7 | 13 |
| β-strand | 200-206 | 7 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| I2 heavy chain | A | protein | 232 | Homo sapiens | Q6GMX6 (AlphaFold model) |
| I2 light chain | B | protein | 213 | Homo sapiens |
>4QHN_1 I2 heavy chain (chains A) QVQLQESGPGVVKSSETLSLTCTVSGGSMGGTYWSWLRLSPGKGLEWIGYIFHTGHTNYN PSLEGRVSISVDTSEDQFSLRLRSVTAADTAVYFCASLPRGQLVNAYFRNWGRGTLVSVT AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKHHHHHH
>4QHN_2 I2 light chain (chains B) SYELTQPPSVSVSPGQTATITCSGDKVASKNVCWYQVKPGQSPEVVMYENYKRPSGIPDR FSGSKSGSTATLTIRGTQATDEADYYCQVWDSFSTFVFGSGTQVTVLGQPKAAPSVTLFP PSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLS LTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains. Fera, D., Schmidt, A.G., Haynes, B.F. et al. Proc Natl Acad Sci U S A (2014) 111:10275-10280. DOI 10.1073/pnas.1409954111 · PubMed
Other PDB entries of the same protein (UniProt Q6GMX6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4QHN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.