4QQI: ANKRA2-RFX7 complex

Crystal structure of ANKRA2-RFX7 complex. Determined by X-ray diffraction at 2.03 Å resolution. Released 3 Sept 2014.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,591
Mol. weight: 23.31 kDa
Released: 3 Sept 2014

Explore 4QQI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QQI contains 14 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	144-147	4
α-helix	148-150	3
α-helix	153-159	7
α-helix	162-171	10
α-helix	185-191	7
α-helix	195-203	9
α-helix	218-225	8
α-helix	228-236	9
α-helix	251-257	7
α-helix	261-269	9
α-helix	284-291	8
α-helix	294-305	12
α-helix	308-310	3

Chain X: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	89-94	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ankyrin repeat family A protein 2	A	protein	190	Homo sapiens	Q9H9E1 (AlphaFold model)
DNA-binding protein RFX7	X	protein	17	Homo sapiens	Q2KHR2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4QQI_1 Ankyrin repeat family A protein 2 (chains A)
MHHHHHHSSGRENLYFQGSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGF
TPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNE
YDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESH
LLKLLQNIKE

Sequence of entity 2 (X), FASTA

>4QQI_2 DNA-binding protein RFX7 (chains X)
KAFVHMPTLPNLDFHKT

Primary citation

Crystal structure of ANKRA2-RFX7 complex. Xu, C., Tempel, W., Mackenzie, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9H9E1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V31 1.57 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
4LG6 1.8 Å, Crystal structure of ANKRA2-CCDC8 complex
3V2X 1.85 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
3V2O 1.89 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
3SO8 1.9 Å, Crystal Structure of ANKRA
8CXG 3.2 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…
8CXH 3.2 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…
8CXI 3.4 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…

Browse structure collections

About this viewer

MolViewer shows 4QQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.