4QXO: HSTING(group2)

Crystal structure of hSTING(group2) in complex with DMXAA. Determined by X-ray diffraction at 1.88 Å resolution. Released 10 Sept 2014.

Method: X-ray diffraction
Resolution: 1.88 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,649
Mol. weight: 21.93 kDa
Ligands: 1YE
Released: 10 Sept 2014

Explore 4QXO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QXO contains 14 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	155-163	9
α-helix	164-168	5
α-helix	169-171	3
α-helix	172-174	3
α-helix	175-182	8
α-helix	183-185	3
α-helix	189-191	3
α-helix	193-195	3
β-strand	198-203	6	1
α-helix	212-215	4
β-strand	219-224	6	1
α-helix	225-227	3
β-strand	228-230	3	2
β-strand	238-240	3	2
β-strand	243-249	7	1
β-strand	252-261	10	1
α-helix	264-273	10
α-helix	275-277	3
α-helix	281-301	21
β-strand	309-314	6	1
α-helix	325-333	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stimulator of interferon genes protein	A	protein	188	Homo sapiens	Q86WV6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4QXO_1 Stimulator of interferon genes protein (chains A)
SVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLS
MADPNIRFRDMLPQQNIDRAGIKNRVYSNSVYELLENGQRAGTCVLEYATPLQTLFAMSQ
YSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHL
RQEEKEEV

Ligands and cofactors

ID	Name	Formula	Copies
1YE	(5,6-dimethyl-9-oxo-9H-xanthen-4-yl)acetic acid	C17 H14 O4	1

Primary citation

Binding-Pocket and Lid-Region Substitutions Render Human STING Sensitive to the Species-Specific Drug DMXAA. Gao, P., Zillinger, T., Wang, W. et al. Cell Rep (2014) 8:1668-1676. DOI 10.1016/j.celrep.2014.08.010 · PubMed

Other PDB entries of the same protein (UniProt Q86WV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MX3 1.36 Å, Crystal structure of human STING (G230A, H232R, R293Q) in complex with Compound 1
4EMT 1.5 Å, Crystal Structure of human STING bound to c-di-GMP
6UKZ 1.52 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 6
9CUD 1.53 Å, Human STING G230A/R293Q variant bound to diABZI-i
6UKU 1.68 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 3
7ZKU 1.7 Å, Crystal structure of human STING in complex with 3',3'-c-(2'F,2'dAMP-2'd<carba>GMP)
8STI 1.72 Å, human STING with agonist XMT-1616
6MX0 1.73 Å, Crystal structure of human STING apoprotein (G230A, H232R, R293Q)
6UKM 1.74 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound MSA-2
9VZG 1.74 Å, Harnessing Noncovalent Dimerization Enables an Orally Active STING Agonist for…
6UL0 1.76 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 4
6XNP 1.77 Å, Crystal Structure of Human STING CTD complex with SR-717

Browse structure collections

About this viewer

MolViewer shows 4QXO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.