4QY5: Beta-lactamase TEM,Beta-lactamase PSE-4

Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations. Determined by X-ray diffraction at 1.5 Å resolution. Released 12 Aug 2015.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: Escherichia coli, Pseudomonas aeruginosa
Chains: 1
Atoms: 2,487
Mol. weight: 29.04 kDa
Ligands: MG
Released: 12 Aug 2015

Explore 4QY5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QY5 contains 15 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	27-40	14
β-strand	43-50	8	1
β-strand	56-60	5	1
β-strand	66-67	2	2
α-helix	69-71	3
α-helix	72-85	14
α-helix	93	1
β-strand	94-95	2	3
α-helix	96	1
α-helix	99-101	3
α-helix	109-111	3
β-strand	117-118	2	3
α-helix	119-128	10
α-helix	132-142	11
α-helix	145-154	10
α-helix	168-170	3
β-strand	180-181	2	2
α-helix	183-194	12
α-helix	201-212	12
α-helix	225-226	2
β-strand	230-237	8	1
β-strand	244-251	8	1
β-strand	259-266	8	1
α-helix	272-288	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-lactamase TEM,Beta-lactamase PSE-4	A	protein	263	Escherichia coli, Pseudomonas aeruginosa	P16897 (AlphaFold model), P62593 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4QY5_1 Beta-lactamase TEM,Beta-lactamase PSE-4 (chains A)
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVD
AGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGP
KELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQ
QLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTG
SQATMDERNRQIAEIGASLIKHW

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations. Park, J., Gobeil, S., Pelletier, J.N. et al. To be published.

Other PDB entries of the same protein (UniProt P16897 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ID4 1.05 Å, Crystal structure of chimeric beta-lactamase cTEM-17m
4R4S 1.1 Å, Crystal structure of chimeric beta-lactamase cTEM-19m at 1.1 angstrom resolution
4QY6 1.15 Å, Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
4R4R 1.2 Å, Crystal structure of chimeric beta-lactamase cTEM-19m at 1.2 angstrom resolution
1G6A 1.75 Å, Pse-4 carbenicillinase, R234K mutant
1G68 1.95 Å, Pse-4 carbenicillinase, wild type
8J6Y 2.4 Å, Crystal structure of class A beta-lactamase PSE-4 WT- Apo state

Browse structure collections

About this viewer

MolViewer shows 4QY5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.