4R26: PGR124-Light Chain

Crystal structure of human Fab PGT124, a broadly neutralizing and potent HIV-1 neutralizing antibody. Determined by X-ray diffraction at 2.5 Å resolution. Released 8 Oct 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Nomascus leucogenys, Homo sapiens
Chains: 2
Atoms: 3,398
Mol. weight: 48.79 kDa
Released: 8 Oct 2014

Explore 4R26 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4R26 contains 16 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	11-12	2	9
β-strand	18-25	8	8
α-helix	29-31	3
β-strand	33-39	7	4
β-strand	45-51	7	4
β-strand	57-59	3	4
α-helix	61-63	3
β-strand	67-72	6	8
α-helix	73-75	3
β-strand	77-82	6	8
α-helix	84-86	3
β-strand	88-95	8	4
β-strand	96-100A	6	10
β-strand	100J-100O	6	10
β-strand	103	1	4
β-strand	108-109	2	4
β-strand	110-111	2	9
α-helix	115-116	2
β-strand	117	1	11
α-helix	118-119	2
β-strand	120-124	5	12
β-strand	135-145	11	12
β-strand	146	1	11
β-strand	151-154	4	13
β-strand	160	1	14
β-strand	162	1	14
β-strand	163-165	3	12
α-helix	166-168	3
β-strand	169-170	2	12
β-strand	176-185	10	12
α-helix	186-188	3
β-strand	195-200	6	13
β-strand	205-210	6	13

Chain L: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	6-14	7	1
β-strand	19-22	4	2
α-helix	23	1
β-strand	32-38	7	1
β-strand	45-48	4	1
β-strand	49	1	3
β-strand	53	1	3
β-strand	62-63	2	2
β-strand	72-75	4	2
α-helix	80-82	3
β-strand	84-91	8	1
β-strand	97	1	4
β-strand	101-106A	7	1
α-helix	108-110	3
β-strand	111	1	5
α-helix	112-113	2
β-strand	114-118	5	6
α-helix	119-121	3
α-helix	122-126	5
β-strand	130-139	10	6
β-strand	140	1	5
β-strand	145-150	6	7
β-strand	153-155	3	7
β-strand	159-161	3	6
α-helix	162-164	3
β-strand	165-166	2	6
β-strand	172-180	9	6
α-helix	182-185	4
β-strand	191-197	7	7
β-strand	200-206	7	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PGR124-Light Chain	L	protein	214	Nomascus leucogenys, Homo sapiens	P0DOY3 (AlphaFold model)
PGT124-Heavy Chain	H	protein	236	Homo sapiens	P0DOX5 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>4R26_1 PGR124-Light Chain (chains L)
SYVSPLSVALGETARISCGRQALGSRAVQWYQHKPGQAPILLIYNNQDRPSGIPERFSGT
PDINFGTTATLTISGVEVGDEADYYCHMWDSRSGFSWSFGGATRLTVLSQPKAAPSVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL
SLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 2 (H), FASTA

>4R26_2 PGT124-Heavy Chain (chains H)
QVQLQESGPGLVRPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYN
PSLNSRAVISRDTSKNQLSLQLRSVTTADTAIYFCATARRGQRIYGVVSFGEFFYYYYMD
VWGKGTAVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

Primary citation

Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies. Garces, F., Sok, D., Kong, L. et al. Cell (2014) 159:69-79. DOI 10.1016/j.cell.2014.09.009 · PubMed

Other PDB entries of the same protein (UniProt P0DOY3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O5L 1.5 Å, Crystal structure of broadly neutralizing antibody F045-092
4R2G 3.28 Å, Crystal Structure of PGT124 Fab bound to HIV-1 JRCSF gp120 core and to CD4
8XLB Clamda3 domain of human immunoglobulin

Browse structure collections

About this viewer

MolViewer shows 4R26 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.