Clamda3 domain of human immunoglobulin. Determined by solution NMR. Released 5 Feb 2025.
Explore 8XLB in 3D Show helices and sheets RCSB PDB PDBe
8XLB contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| β-strand | 10-11 | 2 | 1 |
| α-helix | 12-14 | 3 | |
| α-helix | 15-19 | 5 | |
| β-strand | 23-32 | 10 | 1 |
| β-strand | 38-42 | 5 | 2 |
| β-strand | 47-48 | 2 | 2 |
| β-strand | 52-59 | 8 | 1 |
| β-strand | 65-73 | 9 | 1 |
| α-helix | 75-79 | 5 | |
| β-strand | 85-90 | 6 | 2 |
| β-strand | 93-95 | 3 | 2 |
| α-helix | 100-102 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin lambda constant 3 | A | protein | 111 | Homo sapiens | P0DOY3 (AlphaFold model) |
>8XLB_1 Immunoglobulin lambda constant 3 (chains A) QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVNAGVETTKPSKQ SNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPAESSENLYFQ
Identification of potential C1-binding sites in the immunoglobulin CL domains. Yanaka, S., Kodama, A., Nishiguchi, S. et al. Int Immunol (2024) 36:405-412. DOI 10.1093/intimm/dxae017 · PubMed
Other PDB entries of the same protein (UniProt P0DOY3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8XLB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.