4R71: Elongation factor Ts, Elongation factor Tu

Structure of the Qbeta holoenzyme complex in the P1211 crystal form. Determined by X-ray diffraction at 3.21 Å resolution. Released 23 Sept 2015.

Method: X-ray diffraction
Resolution: 3.21 Å
Organisms: Escherichia coli, Enterobacteria phage Qbeta
Chains: 6
Atoms: 21,107
Mol. weight: 320.37 kDa
Released: 23 Sept 2015

Explore 4R71 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4R71 contains 120 α-helices and 145 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	6-12	7
α-helix	20-28	9
α-helix	34-43	10
α-helix	46-51	6
α-helix	52-54	3
β-strand	59-66	8	1
β-strand	70-78	9	1
α-helix	81-84	4
α-helix	87-103	17
α-helix	108-114	7
α-helix	116-126	11
β-strand	131-139	9	1
β-strand	142-148	7	2
β-strand	152-159	8	2
α-helix	163-176	14
β-strand	180	1	3
α-helix	183-185	3
α-helix	191-203	13
α-helix	209-222	14
β-strand	228	1	3
β-strand	233-234	2	4
β-strand	237-241	5	4
α-helix	242-249	8
β-strand	252-260	9	2
α-helix	272-279	8
α-helix	1003-1007	5
β-strand	1012-1019	8	5
α-helix	1021-1023	3
α-helix	1025-1040	16
β-strand	1068-1071	4	5
β-strand	1076-1081	6	5
α-helix	1085-1094	10
β-strand	1101-1107	7	5
α-helix	1116-1125	10
β-strand	1131-1136	6	5
α-helix	1138-1140	3
α-helix	1144-1159	16
α-helix	1165-1167	3
β-strand	1170-1172	3	5
α-helix	1175-1178	4
α-helix	1183-1199	17
α-helix	1201-1205	5
α-helix	1206-1208	3
α-helix	1210-1211	2
β-strand	1212-1214	3	6
β-strand	1217-1221	5	7
β-strand	1225-1231	7	7
β-strand	1234	1	6
β-strand	1236-1238	3	8
β-strand	1242-1247	6	6
β-strand	1249-1255	7	6
β-strand	1256-1260	5	7
β-strand	1265-1266	2	7
β-strand	1268-1270	3	8
β-strand	1274-1279	6	7
α-helix	1284-1286	3
β-strand	1289	1	9
β-strand	1291	1	9
β-strand	1292-1294	3	6
β-strand	1300-1311	12	10
β-strand	1323	1	11
β-strand	1330-1333	4	10
β-strand	1336-1343	8	10
α-helix	1344-1345	2
β-strand	1351	1	11
β-strand	1356-1369	14	10
β-strand	1374-1379	6	10
β-strand	1382-1392	11	10

Chain B: 27 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	11-19	9
α-helix	29-40	12
α-helix	49-52	4
α-helix	63-75	13
α-helix	88-111	24
α-helix	121-139	19
α-helix	145-151	7
β-strand	159	1	12
β-strand	162	1	12
α-helix	164-166	3
α-helix	169-174	6
β-strand	177-179	3	13
α-helix	181-183	3
α-helix	184-191	8
β-strand	200-203	4	13
β-strand	206-213	8	14
β-strand	219-224	6	14
α-helix	227-244	18
α-helix	245-247	3
α-helix	255-267	13
β-strand	270-273	4	15
β-strand	275	1	16
α-helix	278-281	4
β-strand	283	1	17
α-helix	284-290	7
α-helix	293-302	10
β-strand	306-308	3	14
β-strand	314-316	3	14
β-strand	319	1	17
α-helix	328-347	20
β-strand	355-357	3	15
β-strand	360-364	5	15
α-helix	365-367	3
α-helix	368-377	10
β-strand	382	1	16
β-strand	388	1	15
β-strand	393-396	4	18
β-strand	399-402	4	18
β-strand	405-406	2	18
α-helix	419-433	15
β-strand	435	1	19
β-strand	438	1	19
α-helix	439-440	2
α-helix	441-451	11
α-helix	457-460	4
β-strand	462-463	2	20
β-strand	472-473	2	20
α-helix	476-478	3
β-strand	483-484	2	21
β-strand	489-501	13	21
α-helix	505-517	13
α-helix	538-543	6
β-strand	553-566	14	21

Chain C: 30 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	20-28	9
α-helix	34-43	10
α-helix	45-51	7
α-helix	52-54	3
β-strand	59-66	8	22
β-strand	71-78	8	22
α-helix	81-84	4
α-helix	87-103	17
α-helix	108-114	7
α-helix	116-126	11
β-strand	131-138	8	22
β-strand	142-148	7	23
β-strand	152-159	8	23
α-helix	163-176	14
β-strand	180	1	24
α-helix	183-185	3
α-helix	190-205	16
α-helix	209-222	14
β-strand	228	1	24
β-strand	233-234	2	25
β-strand	237-241	5	25
α-helix	242-249	8
β-strand	252-260	9	23
α-helix	272-280	9
α-helix	1004-1007	4
β-strand	1011-1018	8	26
α-helix	1020-1022	3
α-helix	1024-1039	16
β-strand	1067-1070	4	26
β-strand	1075-1080	6	26
α-helix	1084-1093	10
β-strand	1100-1106	7	26
α-helix	1115-1125	11
β-strand	1130-1135	6	26
α-helix	1137-1139	3
α-helix	1143-1158	16
α-helix	1164-1166	3
β-strand	1169-1171	3	26
α-helix	1174-1177	4
α-helix	1182-1197	16
α-helix	1200-1204	5
α-helix	1205-1207	3
α-helix	1209-1210	2
β-strand	1211-1213	3	27
β-strand	1216-1220	5	28
β-strand	1224-1230	7	28
β-strand	1233	1	27
β-strand	1235-1237	3	29
β-strand	1241-1246	6	27
β-strand	1248-1254	7	27
β-strand	1255-1259	5	28
β-strand	1264-1265	2	28
β-strand	1267-1269	3	29
β-strand	1273-1278	6	28
α-helix	1283-1285	3
β-strand	1288	1	30
β-strand	1290	1	30
β-strand	1291-1293	3	27
β-strand	1299-1310	12	31
β-strand	1322	1	32
β-strand	1329-1332	4	31
β-strand	1335-1340	6	31
α-helix	1343-1344	2
β-strand	1350	1	32
β-strand	1355-1368	14	31
β-strand	1373-1378	6	31
β-strand	1381-1391	11	31

Chain D: 25 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	11-19	9
α-helix	29-40	12
α-helix	49-54	6
α-helix	63-72	10
α-helix	90-111	22
α-helix	121-139	19
α-helix	145-151	7
α-helix	164-166	3
α-helix	169-174	6
α-helix	176	1
β-strand	177-179	3	33
α-helix	184-191	8
β-strand	200-203	4	33
β-strand	206-213	8	34
β-strand	219-224	6	34
α-helix	227-244	18
α-helix	255-267	13
β-strand	270-274	5	35
β-strand	275	1	36
α-helix	278-280	3
β-strand	283	1	37
α-helix	284-290	7
α-helix	293-302	10
β-strand	306-308	3	34
β-strand	314-316	3	34
β-strand	319	1	37
α-helix	328-346	19
β-strand	355-357	3	35
β-strand	360-364	5	35
α-helix	365-367	3
α-helix	368-378	11
β-strand	382	1	36
β-strand	388	1	35
β-strand	393-396	4	38
β-strand	399-402	4	38
β-strand	405-406	2	38
α-helix	419-433	15
β-strand	435	1	39
β-strand	438	1	39
α-helix	441-451	11
α-helix	457-460	4
β-strand	462-463	2	40
β-strand	472-473	2	40
α-helix	476-478	3
β-strand	483-485	3	41
β-strand	488-501	14	41
α-helix	505-517	13
α-helix	538-544	7
β-strand	553-566	14	41

Chain E: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	23-31	9	42
β-strand	35-39	5	42
β-strand	46-49	4	42
α-helix	50-53	4
β-strand	67-71	5	42
α-helix	72-73	2
α-helix	92-103	12
β-strand	107-115	9	43
β-strand	120-124	5	43
β-strand	127-131	5	43
β-strand	151-159	9	43
β-strand	166-169	4	43

Chain F: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	23-32	10	44
β-strand	35-39	5	44
β-strand	42	1	33
β-strand	46-49	4	44
α-helix	50-53	4
β-strand	67-71	5	44
α-helix	72-73	2
α-helix	92-103	12
β-strand	107-115	9	45
β-strand	120-124	5	45
β-strand	127-131	5	45
β-strand	151-159	9	45
β-strand	166-169	4	45

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor Ts, Elongation factor Tu	A, C	protein	694	Escherichia coli	P0A6P1 (AlphaFold model), P0CE48 (AlphaFold model)
RNA-directed RNA polymerase beta chain	B, D	protein	595	Enterobacteria phage Qbeta	P14647
30S ribosomal protein S1	E, F	protein	171	Escherichia coli	P0AG67 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4R71_1 Elongation factor Ts, Elongation factor Tu (chains A, C)
MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADG
VIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERV
ALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEF
IKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSK
TVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQSHMSKEKFERTKPHVNVG
TIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARGITINTSHVEYDTPTRH
YAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLN
KCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFL
DSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKETQKSTC
TGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILSKDE
GGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFA
IREGGRTVGAGVVAKVLSGASGAAGGGGENLYFQ

Sequence of entity 2 (B, D), FASTA

>4R71_2 RNA-directed RNA polymerase beta chain (chains B, D)
SGGGGSMSKTASSRNSLSAQLRRAANTRIEVEGNLALSIANDLLLAYGQSPFNSEAECIS
FSPRFDGTPDDFRINYLKAEIMSKYDDFSLGIDTEAVAWEKFLAAEAECALTNARLYRPD
YSEDFNFSLGESCIHMARRKIAKLIGDVPSVEGMLRHCRFSGGATTTNNRSYGHPSFKFA
LPQACTPRALKYVLALRASTHFDTRISDISPFNKAVTVPKNSKTDRCIAIEPGWNMFFQL
GIGGILRDRLRCWGIDLNDQTINQRRAHEGSVTNNLATVDLSAASDSISLALCELLLPPG
WFEVLMDLRSPKGRLPDGSVVTYEKISSMGNGYTFELESLIFASLARSVCEILDLDSSEV
TVYGDDIILPSCAVPALREVFKYVGFTTNTKKTFSEGPFRESCGKHYYSGVDVTPFYIRH
RIVSPADLILVLNNLYRWATIDGVWDPRAHSVYLKYRKLLPKQLQRNTIPDGYGDGALVG
SVLINPFAKNRGWIRYVPVITDHTRDRERAELGSYLYDLFSRCLSESNDGLPLRGPSGCD
SADLFAIDQLICRSNPTKISRSTGKFDIQYIACSSRVLAPYGVFQGTKVASLHEA

Sequence of entity 3 (E, F), FASTA

>4R71_3 30S ribosomal protein S1 (chains E, F)
GTESFAQLFEESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGEL
EIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEKAYEDAETVTGVINGKVKGGF
TVELNGIRAFLPGSLVDVRPVRDTLHLEGKELEFKVIKLDQKRNNVVVSRR

Primary citation

Structural basis for RNA-genome recognition during bacteriophage Q beta replication. Gytz, H., Mohr, D., Seweryn, P. et al. Nucleic Acids Res (2015) 43:10893-10906. DOI 10.1093/nar/gkv1212 · PubMed

Other PDB entries of the same protein (UniProt P0A6P1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PC3 1.83 Å, Elongation factor Tu:Ts complex with partially bound GDP
1EFU 2.5 Å, Elongation factor complex ef-tu/ef-ts from escherichia coli
3MMP 2.5 Å, Structure of the Qb replicase, an RNA-dependent RNA polymerase consisting of viral and…
4Q7J 2.9 Å, Complex structure of viral RNA polymerase
4PC7 3.6 Å, Elongation factor Tu:Ts complex in a near GTP conformation.

Browse structure collections

About this viewer

MolViewer shows 4R71 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.